Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.77
PubTator Score 3.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
astrocytic glioma -2.300 1.2e-03
atypical teratoid / rhabdoid tumor -2.000 2.5e-03
Breast cancer -1.300 2.6e-03
ductal carcinoma in situ 1.800 2.7e-02
Endometriosis -1.195 2.5e-02
ependymoma -2.900 8.3e-03
glioblastoma -1.600 2.7e-03
group 4 medulloblastoma -1.300 2.6e-02
head and neck cancer and chronic obstruc... -1.200 3.4e-04
interstitial cystitis -1.600 8.0e-03
intraductal papillary-mucinous adenoma (... 1.200 3.7e-02
intraductal papillary-mucinous carcinoma... 2.400 4.3e-04
intraductal papillary-mucinous neoplasm ... 1.500 8.6e-03
medulloblastoma, large-cell -2.500 5.3e-03
non-small cell lung cancer 1.706 4.7e-06
oligodendroglioma -1.400 2.8e-02
ovarian cancer -1.300 1.3e-04
pituitary cancer 1.400 3.7e-02
primitive neuroectodermal tumor -1.800 2.5e-03
progressive supranuclear palsy 1.600 4.8e-03
psoriasis 1.100 1.1e-07
spina bifida -2.837 2.9e-02
ulcerative colitis -1.200 3.9e-02

Gene RIF (2)

AA Sequence

MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSR      1 - 70
HHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALCEPGDLLELLWLQPAPEPPAP     71 - 140
APHWAVYVGGGQIIHLHQGEIRQDSLYEAGAANVGRVVNSWYRYRPLVAELVVQNACGHLGLKSEEICWT    141 - 210
NSESFAAWCRFGKREFKAGGEVPAGTQPPQQQYYLKVHLGENKVHTARFHSLEDLIREKRRIDASGRLRV    211 - 280
LQELADLVDDKE                                                              281 - 292
//

Text Mined References (7)

PMID Year Title