Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.77
PubTator Score 3.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Polycystic Ovary Syndrome 335
Disease Target Count P-value
psoriasis 6685 1.12463228824639E-7
non-small cell lung cancer 2798 4.69507150277718E-6
interstitial cystitis 2299 2.6826296732177E-5
ovarian cancer 8492 1.34694194713976E-4
head and neck cancer and chronic obstructive pulmonary disease 237 3.40049756668602E-4
atypical teratoid / rhabdoid tumor 4369 4.29638172104221E-4
astrocytic glioma 2241 0.0012463865601126
primitive neuroectodermal tumor 3031 0.00248843564128789
Breast cancer 3099 0.00256402699921054
glioblastoma 5572 0.00271277636635671
medulloblastoma, large-cell 6234 0.0032077579043672
progressive supranuclear palsy 674 0.0047872967923005
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0053698738874181
sonic hedgehog group medulloblastoma 1482 0.00691129448497015
ependymoma 2514 0.00829229544635794
Endometriosis 535 0.0247139722021165
ductal carcinoma in situ 1745 0.0272407587787825
oligodendroglioma 2849 0.0282682580789365
spina bifida 1064 0.0294440173606223
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0331358608115503
pituitary cancer 1972 0.0372136146623043
intraductal papillary-mucinous adenoma (IPMA) 2956 0.037227933973549
ulcerative colitis 2087 0.0393996810817262
Disease Target Count Z-score Confidence
Feingold syndrome 14 4.774 2.4

Expression

Gene RIF (2)

PMID Text
18667531 Nse1 RING-like motif is a protein-protein interaction domain required for Smc5-Smc6 holocomplex integrity and recruitment to, or retention at, DNA lesions
16820875 up-regulation of FAM84A may play a critical role in progression of colon cancer

AA Sequence

MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSR      1 - 70
HHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALCEPGDLLELLWLQPAPEPPAP     71 - 140
APHWAVYVGGGQIIHLHQGEIRQDSLYEAGAANVGRVVNSWYRYRPLVAELVVQNACGHLGLKSEEICWT    141 - 210
NSESFAAWCRFGKREFKAGGEVPAGTQPPQQQYYLKVHLGENKVHTARFHSLEDLIREKRRIDASGRLRV    211 - 280
LQELADLVDDKE                                                              281 - 292
//

Text Mined References (7)

PMID Year Title
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
18667531 2008 Nse1 RING-like domain supports functions of the Smc5-Smc6 holocomplex in genome stability.
16820875 2006 A gene encoding a family with sequence similarity 84, member A (FAM84A) enhanced migration of human colon cancer cells.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.