Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.77
PubTator Score 3.70

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96KN4 A6NP76 Q86UZ2 Q8NAH7 Q8TAM5
Symbols NSE1
PP11517

Gene

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
18667531 Nse1 RING-like motif is a protein-protein interaction domain required for Smc5-Smc6 holocomplex integrity and recruitment to, or retention at, DNA lesions
16820875 up-regulation of FAM84A may play a critical role in progression of colon cancer

AA Sequence

MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSR      1 - 70
HHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALCEPGDLLELLWLQPAPEPPAP     71 - 140
APHWAVYVGGGQIIHLHQGEIRQDSLYEAGAANVGRVVNSWYRYRPLVAELVVQNACGHLGLKSEEICWT    141 - 210
NSESFAAWCRFGKREFKAGGEVPAGTQPPQQQYYLKVHLGENKVHTARFHSLEDLIREKRRIDASGRLRV    211 - 280
LQELADLVDDKE                                                              281 - 292
//

Text Mined References (7)

PMID Year Title
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
18667531 2008 Nse1 RING-like domain supports functions of the Smc5-Smc6 holocomplex in genome stability.
16820875 2006 A gene encoding a family with sequence similarity 84, member A (FAM84A) enhanced migration of human colon cancer cells.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.