Property Summary

NCBI Gene PubMed Count 40
Grant Count 33
R01 Count 16
Funding $2,632,537.14
PubMed Score 75.82
PubTator Score 85.08

Knowledge Summary

Patent

No data available

Expression

Gene RIF (39)

PMID Text
26439389 Data shows that higher carnosine content in human skeletal muscle is positively associated with insulin resistance and fasting metabolic preference for glucose.
26206726 CNDP1 and CARNS are expressed in glomeruli and tubular cells; TauT is expressed in renal epithelial cells; CDNP1 may have a role in diabetic neuropathy
25898255 In gastrointestinal cancer, reduced plasma levels of CNDP1 associate with signs of catabolism and poor outcome.
24566305 Alterations of serum carnosinase (CN1) activity has been associated with several pathological conditions, such as neurological disorders, chronic diseases and cancer
23402577 This meta-analysis confirms that the carnosinase D18S880 microsatellite polymorphism is associated with daibetic nephropathy susceptibility, especially in the type 2 DM and the Caucasian population.
23342076 Rs12604675-A in CNDP1 may confer susceptibility to overt proteinuria in Japanese women with type 2 diabetes.
23029420 Plasma levels of FLT and S100A9 proteins are up-regulated and CNDP1 levels are down-regulated in patients with glioblastoma.
22706107 In this review, correlations between serum carnosine and carnosinase activity and polymorphism in CNDP1 gene are analyzed. The role of CNDP1 gene polymorphism the development of diabetic nephropathy and non-diabetic chronic kidney disease is discussed.
21573905 Common variants in CNDP1 and CNDP2 play a role in susceptibility to kidney disease in patients with type 2 diabetes.
21393041 These findings provide nominal evidence supporting a role between CNDP1 variants and diabetic kidney disease.
More...

AA Sequence

MDPKLGRMAASLLAVLLLLLERGMFSSPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRF      1 - 70
RQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPIILAELGSDPTKGTVCFYGHLDVQPADR     71 - 140
GDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELV    141 - 210
EKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALL    211 - 280
GSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIH    281 - 350
GIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIA    351 - 420
NIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYI    421 - 490
EGTKLFAAFFLEMAQLH                                                         491 - 507
//

Text Mined References (41)

PMID Year Title
26439389 2015 Muscle Carnosine Is Associated with Cardiometabolic Risk Factors in Humans.
26206726 2015 Intrinsic carnosine metabolism in the human kidney.
25898255 2015 Circulating carnosine dipeptidase 1 associates with weight loss and poor prognosis in gastrointestinal cancer.
24891507 2014 Metabolite proofreading in carnosine and homocarnosine synthesis: molecular identification of PM20D2 as ?-alanyl-lysine dipeptidase.
24566305 2014 Carnosinases, their substrates and diseases.
23402577 2013 D18S880 microsatellite polymorphism of carnosinase gene and diabetic nephropathy: a meta-analysis.
23342076 2013 The influence of a single nucleotide polymorphism within CNDP1 on susceptibility to diabetic nephropathy in Japanese women with type 2 diabetes.
23029420 2012 Proteins with altered levels in plasma from glioblastoma patients as revealed by iTRAQ-based quantitative proteomic analysis.
22706107 2012 [Carnosine, carnosinase and kidney diseases].
21573905 2011 Common variants in CNDP1 and CNDP2, and risk of nephropathy in type 2 diabetes.
More...