Property Summary

NCBI Gene PubMed Count 44
PubMed Score 81.00
PubTator Score 85.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -2.800 4.0e-02
Astrocytoma, Pilocytic -3.400 1.0e-05
atypical teratoid / rhabdoid tumor -1.700 1.4e-02
ependymoma -3.700 1.5e-02
glioblastoma -1.700 1.4e-02
group 3 medulloblastoma -4.200 1.4e-03
medulloblastoma, large-cell -1.800 4.7e-02
oligodendroglioma -1.900 3.8e-08
osteosarcoma 1.255 1.3e-02
ovarian cancer 1.100 2.8e-09
pancreatic ductal adenocarcinoma liver m... -1.936 6.5e-03
pediatric high grade glioma -2.400 1.6e-03
primitive neuroectodermal tumor -2.300 1.8e-02
progressive supranuclear palsy -1.400 1.6e-02
psoriasis -2.300 4.3e-35
subependymal giant cell astrocytoma -5.466 3.6e-03

 GWAS Trait (1)

Gene RIF (43)

AA Sequence

MDPKLGRMAASLLAVLLLLLERGMFSSPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRF      1 - 70
RQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPIILAELGSDPTKGTVCFYGHLDVQPADR     71 - 140
GDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELV    141 - 210
EKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALL    211 - 280
GSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIH    281 - 350
GIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIA    351 - 420
NIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYI    421 - 490
EGTKLFAAFFLEMAQLH                                                         491 - 507
//

Text Mined References (45)

PMID Year Title