Property Summary

NCBI Gene PubMed Count 21
Grant Count 4
R01 Count 4
Funding $167,185.33
PubMed Score 6.11
PubTator Score 5.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Gene RIF (4)

PMID Text
26759717 Data suggest that FAM84B protein and the NOTCH pathway are involved in the progression of esophageal squamous cell carcinoma (ESCC) and may be potential diagnostic targets for ESCC susceptibility.
25980316 We demonstrated the decreased of circulating FAM84B mRNA and protein after neoadjuvant CRT may predict pCR, and FAM84B protein is overexpressed in ESCC.
20158306 Observational study of gene-disease association. (HuGE Navigator)
19549893 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGNQVEKLTHLSYKEVPTADPTGVDRDDGPRIGVSYIFSNDDEDVEPQPPPQGPDGGGLPDGGDGPPPPQ      1 - 70
PQPYDPRLHEVECSVFYRDECIYQKSFAPGSAALSTYTPENLLNKCKPGDLVEFVSQAQYPHWAVYVGNF     71 - 140
QVVHLHRLEVINSFLTDASQGRRGRVVNDLYRYKPLSSSAVVRNALAHVGAKERELSWRNSESFAAWCRY    141 - 210
GKREFKIGGELRIGKQPYRLQIQLSAQRSHTLEFQSLEDLIMEKRRNDQIGRAAVLQELATHLHPAEPEE    211 - 280
GDSNVARTTPPPGRPPAPSSEEEDGEAVAH                                            281 - 310
//

Text Mined References (23)

PMID Year Title
26759717 2016 Genomic analyses reveal FAM84B and the NOTCH pathway are associated with the progression of esophageal squamous cell carcinoma.
25980316 2015 Circulating mRNA Profiling in Esophageal Squamous Cell Carcinoma Identifies FAM84B As A Biomarker In Predicting Pathological Response to Neoadjuvant Chemoradiation.
25640309 2015 Systematic identification of molecular links between core and candidate genes in breast cancer.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
23326517 2013 Insights into the genetic architecture of early stage age-related macular degeneration: a genome-wide association study meta-analysis.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21269460 2011 Initial characterization of the human central proteome.
20158306 2010 Variation at 8q24 and 9p24 and risk of epithelial ovarian cancer.
20062064 2010 Common variants at 2q37.3, 8q24.21, 15q21.3 and 16q24.1 influence chronic lymphocytic leukemia risk.
More...