Property Summary

NCBI Gene PubMed Count 22
PubMed Score 6.16
PubTator Score 5.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytoma 2.100 3.8e-18
Astrocytoma, Pilocytic 1.300 2.9e-04
atypical teratoid / rhabdoid tumor 2.000 2.3e-03
breast carcinoma 1.600 4.1e-04
ductal carcinoma in situ 1.400 1.1e-02
ependymoma 2.100 1.1e-10
glioblastoma 1.400 7.8e-04
intraductal papillary-mucinous neoplasm ... 1.300 3.2e-02
invasive ductal carcinoma 1.800 1.7e-02
non primary Sjogren syndrome sicca 1.400 3.1e-02
oligodendroglioma 2.600 2.1e-02
osteosarcoma 1.030 1.9e-04
ovarian cancer -1.200 6.6e-03
pediatric high grade glioma 1.700 8.1e-04
pituitary cancer 2.200 2.3e-07
tuberculosis and treatment for 6 months 1.500 5.0e-05

Synonym

Accession Q96KN1
Symbols NSE2
BCMP101

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (5)

AA Sequence

MGNQVEKLTHLSYKEVPTADPTGVDRDDGPRIGVSYIFSNDDEDVEPQPPPQGPDGGGLPDGGDGPPPPQ      1 - 70
PQPYDPRLHEVECSVFYRDECIYQKSFAPGSAALSTYTPENLLNKCKPGDLVEFVSQAQYPHWAVYVGNF     71 - 140
QVVHLHRLEVINSFLTDASQGRRGRVVNDLYRYKPLSSSAVVRNALAHVGAKERELSWRNSESFAAWCRY    141 - 210
GKREFKIGGELRIGKQPYRLQIQLSAQRSHTLEFQSLEDLIMEKRRNDQIGRAAVLQELATHLHPAEPEE    211 - 280
GDSNVARTTPPPGRPPAPSSEEEDGEAVAH                                            281 - 310
//

Text Mined References (24)

PMID Year Title