Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.99
PubTator Score 7.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
oligodendroglioma 1.300 0.013
esophageal adenocarcinoma -1.300 0.020
psoriasis 1.200 0.007
astrocytoma 1.600 0.004
intraductal papillary-mucinous carcinoma... -1.300 0.012
ovarian cancer 2.500 0.000

Gene RIF (5)

PMID Text
26313240 In conclusion, our case-control study suggests that the CC genotype and C allele at rs2275294 are associated with increased risk of ALS in Han Chinese, particularly females.
23168171 The objective of our study was to examine whether the new single-nucleotide polymorphism in the ZNF512B gene might influence the phenotype of amyotrophic lateral sclerosis
21665992 A functional SNP (rs2275294) in ZNF512B was found to be significantly associated with amyotrophic lateral sclerosis in Japanese.
20639536 Evidence that GAM/ZFp/ZNF512B may potentially maintain homeostasis by affecting the levels of regulators such as E2F1 and Ras, by modulating miR-17-92 miRNAs, by interacting with Drosha, and by interfering with TGFbeta signaling.
18187620 Knockdown of zinc finger protein 512B (ZNF512B) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MTDPFCVGGRRLPGSSKSGPGKDGSRKEVRLPMLHDPPKMGMPVVRGGQTVPGQAPLCFDPGSPASDKTE      1 - 70
GKKKGRPKAENQALRDIPLSLMNDWKDEFKAHSRVKCPNSGCWLEFPSIYGLKYHYQRCQGGAISDRLAF     71 - 140
PCPFCEAAFTSKTQLEKHRIWNHMDRPLPASKPGPISRPVTISRPVGVSKPIGVSKPVTIGKPVGVSKPI    141 - 210
GISKPVSVGRPMPVTKAIPVTRPVPVTKPVTVSRPMPVTKAMPVTKPITVTKSVPVTKPVPVTKPITVTK    211 - 280
LVTVTKPVPVTKPVTVSRPIVVSKPVTVSRPIAISRHTPPCKMVLLTRSENKAPRATGRNSGKKRAADSL    281 - 350
DTCPIPPKQARPENGEYGPSSMGQSSAFQLSADTSSGSLSPGSRPSGGMEALKAAGPASPPEEDPERTKH    351 - 420
RRKQKTPKKFTGEQPSISGTFGLKGLVKAEDKARVHRSKKQEGPGPEDARKKVPAAPITVSKEAPAPVAH    421 - 490
PAPGGPEEQWQRAIHERGEAVCPTCNVVTRKTLVGLKKHMEVCQKLQDALKCQHCRKQFKSKAGLNYHTM    491 - 560
AEHSAKPSDAEASEGGEQEERERLRKVLKQMGRLRCPQEGCGAAFSSLMGYQYHQRRCGKPPCEVDSPSF    561 - 630
PCTHCGKTYRSKAGHDYHVRSEHTAPPPEEPTDKSPEAEDPLGVERTPSGRVRRTSAQVAVFHLQEIAED    631 - 700
ELARDWTKRRMKDDLVPETARLNYTRPGLPTLNPQLLEAWKNEVKEKGHVNCPNDCCEAIYSSVSGLKAH    701 - 770
LASCSKGAHLAGKYRCLLCPKEFSSESGVKYHILKTHAENWFRTSADPPPKHRSQDSLVPKKEKKKNLAG    771 - 840
GKKRGRKPKERTPEEPVAKLPPRRDDWPPGCRDKGARGSTGRKVGVSKAPEK                      841 - 892
//

Text Mined References (15)

PMID Year Title
26313240 2015 Association of the functional SNP rs2275294 in ZNF512B with risk of amyotrophic lateral sclerosis and Parkinson's disease in Han Chinese.
25416956 2014 A proteome-scale map of the human interactome network.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23168171 2013 ZNF512B gene is a prognostic factor in patients with amyotrophic lateral sclerosis.
21665992 2011 A functional variant in ZNF512B is associated with susceptibility to amyotrophic lateral sclerosis in Japanese.
20639536 2010 GAM/ZFp/ZNF512B is central to a gene sensor circuitry involving cell-cycle regulators, TGF{beta} effectors, Drosha and microRNAs with opposite oncogenic potentials.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...