Property Summary

NCBI Gene PubMed Count 21
PubMed Score 13.75
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Schizophrenia 501 2.0
psoriasis 6,685

Synonym

Accession Q96KK5
Symbols H2AH
H2A/S
H2AFALii
dJ86C11.1

Gene

 GO Function (1)

 GO Process (1)

Gene RIF (5)

PMID Text
17074886 Protein phosphatase 2C gamma binds to/dephosphorylates H2A to affect chromatin function.
14657027 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11689053 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11080476 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
9566873 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness

AA Sequence

MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNA      1 - 70
ARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAK                 71 - 128
//

Text Mined References (31)

PMID Year Title
25470042 2014 TRIM37 is a new histone H2A ubiquitin ligase and breast cancer oncoprotein.
24352239 2014 Glutamine methylation in histone H2A is an RNA-polymerase-I-dedicated modification.
24140421 2013 VprBP has intrinsic kinase activity targeting histone H2A and represses gene transcription.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22980979 2012 RNF168 ubiquitinates K13-15 on H2A/H2AX to drive DNA damage signaling.
22713238 2012 A novel ubiquitin mark at the N-terminal tail of histone H2As targeted by RNF168 ubiquitin ligase.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19203579 2009 RNF168 binds and amplifies ubiquitin conjugates on damaged chromosomes to allow accumulation of repair proteins.
More...