Property Summary

NCBI Gene PubMed Count 21
PubMed Score 13.86
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 3.0e-05
Disease Target Count Z-score Confidence
Schizophrenia 1160 0.0 3.0
Disease Target Count Z-score Confidence
Intellectual disability 1016 4.68 2.3

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.200 3.0e-05

Gene RIF (5)

AA Sequence

MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNA      1 - 70
ARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAK                 71 - 128
//

Text Mined References (35)

PMID Year Title