Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent (238)

Gene RIF (1)

PMID Text
19833159 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSANTSMVTEFLLLGFSHLADLQGLLFSVFLTIYLLTVAGNFLIVVLVSTDAALQSPMYFFLRTLSALEI      1 - 70
GYTSVTVPLLLHHLLTGRRHISRSGCALQMFFFLFFGATECCLLAAMAYDRYAAICEPLRYPLLLSHRVC     71 - 140
LQLAGSAWACGVLVGLGHTPFIFSLPFCGPNTIPQFFCEIQPVLQLVCGDTSLNELQIILATALLILCPF    141 - 210
GLILGSYGRILVTIFRIPSVAGRRKAFSTCSSHLIMVSLFYGTALFIYIRPKASYDPATDPLVSLFYAVV    211 - 280
TPILNPIIYSLRNTEVKAALKRTIQKTVPMEI                                          281 - 312
//

Text Mined References (10)

PMID Year Title
22908908 2012 Personal receptor repertoires: olfaction as a model.
19833159 2010 Sequence variations at the human leukocyte antigen-linked olfactory receptor cluster do not influence female preferences for male odors.
16939646 2006 A probabilistic classifier for olfactory receptor pseudogenes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12730696 2003 Different noses for different people.
12637542 2003 Complex transcription and splicing of odorant receptor genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.