Property Summary

Ligand Count 3
NCBI Gene PubMed Count 12
PubMed Score 8.70
PubTator Score 6.32

Knowledge Summary

Patent (647)

TINX Plot

  Disease (4)

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma -1.400 4.1e-02
malignant mesothelioma -4.500 2.4e-08
osteosarcoma 1.432 4.9e-04
ovarian cancer 1.100 2.2e-09

Gene RIF (5)

AA Sequence

MLMLLVRGTHYENLRSKVVLPTPLGGRSTETFVSEFPGPDTGIRWRRSDEALRVNVGGVRRQLSARALAR      1 - 70
FPGTRLGRLQAAASEEQARRLCDDYDEAAREFYFDRHPGFFLSLLHFYRTGHLHVLDELCVFAFGQEADY     71 - 140
WGLGENALAACCRARYLERRLTQPHAWDEDSDTPSSVDPCPDEISDVQRELARYGAARCGRLRRRLWLTM    141 - 210
ENPGYSLPSKLFSCVSISVVLASIAAMCIHSLPEYQAREAAAAVAAVAAGRSPEGVRDDPVLRRLEYFCI    211 - 280
AWFSFEVSSRLLLAPSTRNFFCHPLNLIDIVSVLPFYLTLLAGVALGDQGGKEFGHLGKVVQVFRLMRIF    281 - 350
RVLKLARHSTGLRSLGATLKHSYREVGILLLYLAVGVSVFSGVAYTAEKEEDVGFNTIPACWWWGTVSMT    351 - 420
TVGYGDVVPVTVAGKLAASGCILGGILVVALPITIIFNKFSHFYRRQKALEAAVRNSNHQEFEDLLSSID    421 - 490
GVSEASLETSRETSQEGQSADLESQAPSEPPHPQMY                                      491 - 526
//

Text Mined References (12)

PMID Year Title