Property Summary

NCBI Gene PubMed Count 3
PubMed Score 383.59
PubTator Score 21.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 0.038

Gene RIF (2)

PMID Text
22265842 The loss of MSLNL may be associated with the evolution of the olfactory system in African great apes including human.
21841505 High megakaryocyte potentiating factor is associated with mesothelioma.

AA Sequence

MAAAVTIPGPRIGALQSSGLTLLLSLAAHCSGPQAKVLSPGGLDASGANLWASANCSLLQGFWCQPASQL      1 - 70
PRDQLSALIQRLALLQVPLQAWQLSCLANLASRCGLQDDFTLHPPNLLLFYNLSQVREADCRAFIRRAAQ     71 - 140
GDVELLSHLPDQRVALWRAAVACLVGAGLRLSASDQQLLGALVCDMDASSIGAADPHMLENLRRCPRLTA    141 - 210
AQRIALNSLLAGGKTSLGPPGSWTLEGLQALGPLATYISPHLWAQVQEAVGLGFFRSVVASCQVGRLGQR    211 - 280
EARCFVTSFLESKTKPVSSRPRLSTGNITAATLRDDLFLVHYDCAELESCLDGCILRTNLDTLLQHLLPT    281 - 350
ECQHVVKAKLAQIYPQGLPEDQLRLITSLVYLYSRTEIGQWSITSQDTVMALLASDVALENQTEAVLQKF    351 - 420
LEHNGTVSGALLLAIGGTRLCWMSPHQIQTIHPQELRLAGALDLSSCPQSRKDVLYTKAHETFGSSGTLA    421 - 490
AYYRLMRPYLGGSPGGAQPPSPVPPGGAPVEELRHLAHANISMDIDTFTSLNPLELQSLDVGNVTALLGH    491 - 560
NVGDLQKARSHPTVRAWLRSLNSSTLGQLGLDASPTSPTGPAHGTRGPPSTTHQVLHLVHTSGLPTNDAQ    561 - 630
ASTSGSLWAPLGYLPLAMALPCSLLCLLHWGTCILVSVDSVASGWLGSQGSGAGKTEVLDSAGRPLGLTG    631 - 700
QL                                                                        701 - 702
//

Text Mined References (4)

PMID Year Title
22265842 2012 Inactivation of the MSLNL gene encoding mesothelin-like protein during African great ape evolution.
21841505 2011 Soluble mesothelin, megakaryocyte potentiating factor, and osteopontin as markers of patient response and outcome in mesothelioma.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.