Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 2.6e-09

Synonym

Accession Q96KH6
Symbols HEIL1
HsT2508

Gene

 Compartment GO Term (0)

AA Sequence

MERIVHCEGIVSWDNLYREYNTMASTFGPKDILVLPLATDSFFVIGKVTSSLWASVSSFLNNKKIPHGAW      1 - 70
LLSPCLHFLQALLVCAQVYLPLPVRSLLCICTCPPFVCSLSDTGLPLFPPTASLNPAMCHNGVELSFWMM     71 - 140
WRDLTLMPFPSHQANLASSSTHGISQNAESGREIEHQG                                    141 - 178
//

Text Mined References (1)

PMID Year Title