Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Synonym

Accession Q96KH6
Symbols HEIL1
HsT2508

Gene

 Compartment GO Term (0)

AA Sequence

MERIVHCEGIVSWDNLYREYNTMASTFGPKDILVLPLATDSFFVIGKVTSSLWASVSSFLNNKKIPHGAW      1 - 70
LLSPCLHFLQALLVCAQVYLPLPVRSLLCICTCPPFVCSLSDTGLPLFPPTASLNPAMCHNGVELSFWMM     71 - 140
WRDLTLMPFPSHQANLASSSTHGISQNAESGREIEHQG                                    141 - 178
//

Text Mined References (1)

PMID Year Title
23456168 2013 Genome-wide association study in Han Chinese identifies three novel loci for human height.