Property Summary

NCBI Gene PubMed Count 33
Grant Count 7
Funding $422,015.5
PubMed Score 51.69
PubTator Score 30.89

Knowledge Summary

Patent (12,114)

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.900 0.000

Synonym

Accession Q96KG9 A6NJF1 Q96G50 Q96KG8 Q96KH1 Q9HAW5 Q9HBL3 Q9NR53
Symbols GKLP
NKTL
NTKL
P105
TAPK
TEIF
TRAP
HT019
SCAR21

Gene

 Collection (1)

Gene RIF (14)

PMID Text
26581903 Disruptive SCYL1 mutations underlie a syndrome characterized by recurrent episodes of liver failure, peripheral neuropathy, cerebellar atrophy, and ataxia.
25575811 Data identified the large GTPase dynamin2 as an interacting protein of NTKL, which might be responsible for the phenotype alterations caused by NTKL overexpression, such as cytokinesis failure, increased cell motility and abnormal of cell division.
24769208 TEIF is a downstream effector in EGF/PI3K/Akt signaling.
24481816 Data reveal that Scyl1 is a key organizer of a subset of the COPI machinery.
24361335 TEIF as a novel MSP58-interacting protein.
22570270 suggested that the interaction of SCYL1BP1/Pirh2 could accelerate Pirh2 degradation through an ubiquitin-dependent pathway. SCYL1BP1 may function as an important tumor suppressor gene in HCC development
20598683 SCYL1-BP1 can be ubiquitinated and degraded by Pirh2 but not by MDM2, which suggests that SCYL1-BP1 can be regulated by Pirh2.
20505071 Scyl1 participates in the nuclear aminoacylation-dependent tRNA export pathway.
20209057 Scyl1 interacts with 58K/formiminotransferase cyclodeaminase (FTCD) and golgin p115, and is required for the maintenance of Golgi morphology
19958622 TEIF protein and centrosome amplification is commonly found in colorectal tumors. The expression level of TEIF is related to tumor histological grade and malignant degree.
More...

AA Sequence

MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKT      1 - 70
LRHPNILAYIDGLETEKCLHVVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHN     71 - 140
NVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPELEQYDPPELADSSGRVVREKWSADMWRLGC    141 - 210
LIWEVFNGPLPRAAALRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSNRFVETNLFLE    211 - 280
EIQIKEPAEKQKFFQELSKSLDAFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKI    281 - 350
IPVVVKMFSSTDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKSMLLLAPKLN    351 - 420
EANLNVELMKHFARLQAKDEQGPIRCNTTVCLGKIGSYLSASTRHRVLTSAFSRATRDPFAPSRVAGVLG    421 - 490
FAATHNLYSMNDCAQKILPVLCGLTVDPEKSVRDQAFKAIRSFLSKLESVSEDPTQLEEVEKDVHAASSP    491 - 560
GMGGAAASWAGWAVTGVSSLTSKLIRSHPTTAPTETNIPQRPTPEGVPAPAPTPVPATPTTSGHWETQEE    561 - 630
DKDTAEDSSTADRWDDEDWGSLEQEAESVLAQQDDWSTGGQVSRASQVSNSDHKSSKSPESDWSSWEAEG    631 - 700
SWEQGWQEPSSQEPPPDGTRLASEYNWGGPESSDKGDPFATLSARPSTQPRPDSWGEDNWEGLETDSRQV    701 - 770
KAELARKKREERRREMEAKRAERKVAKGPMKLGARKLD                                    771 - 808
//

Text Mined References (38)

PMID Year Title
26581903 2015 Disruptive SCYL1 Mutations Underlie a Syndrome Characterized by Recurrent Episodes of Liver Failure, Peripheral Neuropathy, Cerebellar Atrophy, and Ataxia.
25575811 2015 Overexpression of N-terminal kinase like gene promotes tumorigenicity of hepatocellular carcinoma by regulating cell cycle progression and cell motility.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24769208 2014 TEIF associated centrosome activity is regulated by EGF/PI3K/Akt signaling.
24481816 2014 Scyl1 scaffolds class II Arfs to specific subcomplexes of coatomer through the ?-COP appendage domain.
24361335 2014 The 58-kda microspherule protein (MSP58) represses human telomerase reverse transcriptase (hTERT) gene expression and cell proliferation by interacting with telomerase transcriptional element-interacting factor (TEIF).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22570270 2012 SCYL1 binding protein 1 promotes the ubiquitin-dependent degradation of Pirh2 and has tumor-suppressive function in the development of hepatocellular carcinoma.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
21269460 2011 Initial characterization of the human central proteome.
More...