Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
ependymoma 1.100 0.010
oligodendroglioma 1.100 0.012
psoriasis -1.200 0.002
osteosarcoma -1.699 0.000
glioblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -1.400 0.000
lung cancer 1.200 0.002
adult high grade glioma -1.700 0.000

AA Sequence

MSSAPEPPTFKKEPPKEKEFQSPGLRGVRTTTLFRAVNPELFIKPNKPVMAFGLVTLSLCVAYIGYLHAI      1 - 70
QENKKDLYEAIDSEGHSYMRRKTSKWD                                                71 - 97
//

Text Mined References (8)

PMID Year Title
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
21269460 2011 Initial characterization of the human central proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.