Property Summary

NCBI Gene PubMed Count 4
Grant Count 5
Funding $495,108
PubMed Score 113.90
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
26074659 Enhanced methylation of PRAC was positively associated with a high rate of recurrence and progression in nonmuscle invasive bladder cancer patients.
24100630 the pathogenesis of prostate cancer may be due to the expression levels of PRAC protein, and this protein can serve as a potential biomarker for the management of prostate cancer.

AA Sequence

MLCAHFSDQGPAHLTTSKSAFLSNKKTSTLKHLLGETRSDGSACNSGISGGRGRKIP                   1 - 57
//

Text Mined References (6)

PMID Year Title
26074659 2015 Clinical Implications and Prognostic Values of Prostate Cancer Susceptibility Candidate Methylation in Primary Nonmuscle Invasive Bladder Cancer.
24100630 2013 Aberrant expression of the PRAC gene in prostate cancer.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11340635 2001 PRAC: A novel small nuclear protein that is specifically expressed in human prostate and colon.