Property Summary

NCBI Gene PubMed Count 4
PubMed Score 116.55
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Gene RIF (2)

AA Sequence

MLCAHFSDQGPAHLTTSKSAFLSNKKTSTLKHLLGETRSDGSACNSGISGGRGRKIP                   1 - 57
//

Text Mined References (6)

PMID Year Title