Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.20
PubTator Score 1.17

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96KE9 Q8IVQ7 Q9BR94
Symbols BDPL

Gene

PDB

2VKP  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Gene RIF (1)

AA Sequence

MAAELYAPASAAAADLANSNAGAAVGRKAGPRSPPSAPAPAPPPPAPAPPTLGNNHQESPGWRCCRPTLR      1 - 70
ERNALMFNNELMADVHFVVGPPGATRTVPAHKYVLAVGSSVFYAMFYGDLAEVKSEIHIPDVEPAAFLIL     71 - 140
LKYMYSDEIDLEADTVLATLYAAKKYIVPALAKACVNFLETSLEAKNACVLLSQSRLFEEPELTQRCWEV    141 - 210
IDAQAEMALRSEGFCEIDRQTLEIIVTREALNTKEAVVFEAVLNWAEAECKRQGLPITPRNKRHVLGRAL    211 - 280
YLVRIPTMTLEEFANGAAQSDILTLEETHSIFLWYTATNKPRLDFPLTKRKGLAPQRCHRFQSSAYRSNQ    281 - 350
WRYRGRCDSIQFAVDRRVFIAGLGLYGSSSGKAEYSVKIELKRLGVVLAQNLTKFMSDGSSNTFPVWFEH    351 - 420
PVQVEQDTFYTASAVLDGSELSYFGQEGMTEVQCGKVAFQFQCSSDSTNGTGVQGGQIPELIFYA         421 - 485
//

Text Mined References (7)

PMID Year Title