Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.99
PubTator Score 3.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 9.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 9.2e-03

Gene RIF (5)

AA Sequence

MLSSFPHRKTWRKSKKTVKVTRSYPTFPSLNAWEEFRGLLPVDGEPNPGAGLGVEEGLLCRVVHSPEFNL      1 - 70
FLDSVVFESNFIQVKRGRNWRDVYKASNTMALGVTSSVPCLPLPNILLMASVKWHQGQNQTWNRPSIAPN     71 - 140
IFLKRILPLRFVELQVCDHYQRILQLRTVTEKIYYLKLHPDHPETVFHFWIRLVQILQKGLSITTKDPRI    141 - 210
LVTHCLVPKNCSSPSGDSKLVQKKLQASQPSESLIQLMTKGESEALSQIFADLHQQNQLSFRSSRKVETN    211 - 280
KNSSGKDSSREDSIPCTCDLRWRASFTYGEWERENPSGLQPLSLLSTLAASTGPQLAPPIGNSI          281 - 344
//

Text Mined References (9)

PMID Year Title