Property Summary

NCBI Gene PubMed Count 7
Grant Count 1
Funding $144,891.33
PubMed Score 32.20
PubTator Score 13.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Pontocerebellar hypoplasia 29 4.804 2.4

Synonym

Accession Q96KC9 B2RCB5 Q86UE0 Q96M17
Symbols CLPH
C4orf35
NYD-SP26

Gene

 Grant Application (1)

Gene RIF (1)

PMID Text
25632019 Human CABS1 has a peptide motif homologous to the anti-inflammatory peptide sequence of rat SMR1.

AA Sequence

MAEDGLPKIYSHPPTESSKTPTAATIFFGADNAIPKSETTITSEGDHVTSVNEYMLESDFSTTTDNKLTA      1 - 70
KKEKLKSEDDMGTDFIKSTTHLQKEITSLTGTTNSITRDSITEHFMPVKIGNISSPVTTVSLIDFSTDIA     71 - 140
KEDILLATIDTGDAEISITSEVSGTLKDSSAGVADAPAFPRKKDEADMSNYNSSIKSNVPADEAVQVTDS    141 - 210
TIPEAEIPPAPEESFTTIPDITALEEEKITEIDLSVLEDDTSAVATLTDSDEKFITVFELTTSAEKDKDK    211 - 280
REDTLLTDEETTEGASIWMERDTANEAETHSVLLTAVESRYDFVVPASIATNLVEESSTEEDLSETDNTE    281 - 350
TVPKITEPFSGTTSVLDTPDYKEDTSTTETDIFELLKEEPDEFMI                             351 - 395
//

Text Mined References (9)

PMID Year Title
25632019 2015 Calcium-binding protein, spermatid-specific 1 is expressed in human salivary glands and contains an anti-inflammatory motif.
19271754 2009 CLPH, a novel casein kinase 2-phosphorylated disordered protein, is specifically associated with postmeiotic germ cells in rat spermatogenesis.
19208547 2009 CABS1 is a novel calcium-binding protein specifically expressed in elongate spermatids of mice.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.