Property Summary

NCBI Gene PubMed Count 11
Grant Count 10
R01 Count 10
Funding $1,181,042.01
PubMed Score 14.30
PubTator Score 13.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
group 4 medulloblastoma 2.200 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.300 0.000
medulloblastoma, large-cell 2.000 0.000
tuberculosis -1.500 0.000
intraductal papillary-mucinous carcinoma... 1.200 0.020
diabetes mellitus -1.100 0.024
Breast cancer 4.100 0.024
pediatric high grade glioma 1.100 0.000
spina bifida -1.299 0.033
ulcerative colitis 1.200 0.000
pituitary cancer -1.100 0.000
psoriasis 1.400 0.000

Gene RIF (6)

PMID Text
25496667 Genome-wide shRNA screening identifies ARL5B, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
22245584 Arl5b is a trans-golgi-network-localised small G protein that plays a key role in regulating transport along the endosome-trans-golgi network pathway
22172677 Arl8 and SKIP are required for lysosomes to distribute away from the microtubule-organizing center. We identify two kinesin light chain binding motifs in SKIP that are required for lysosomes to accumulate kinesin-1 and redistribute to the cell periphery.
20932310 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)
12853149 ARL8 contains six exons and five introns, and encodes a 179 amino acid protein that shares homology to the other ARL proteins.

AA Sequence

MGLIFAKLWSLFCNQEHKVIIVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEIVVKNTHFLMWDIGGQ      1 - 70
ESLRSSWNTYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMKGCMTAAEISK     71 - 140
YLTLSSIKDHPWHIQSCCALTGEGLCQGLEWMTSRIGVR                                   141 - 179
//

Text Mined References (11)

PMID Year Title
22245584 2012 Arl5b is a Golgi-localised small G protein involved in the regulation of retrograde transport.
22172677 2011 Arl8 and SKIP act together to link lysosomes to kinesin-1.
21658281 2011 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.
20932310 2010 Genome-wide association reveals genetic effects on human A?42 and ? protein levels in cerebrospinal fluids: a case control study.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853149 2003 Isolation of a new member of the ADP-ribosylation like factor gene family, ARL8, from a cartilage cDNA library.
More...