Property Summary

NCBI Gene PubMed Count 11
PubMed Score 14.30
PubTator Score 13.76

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count
Melanoma 261
Sudden Cardiac Arrest 16
Disease Target Count P-value
psoriasis 6685 1.33417828512055E-46
group 4 medulloblastoma 1875 1.99598402566723E-8
medulloblastoma, large-cell 6234 4.11467910306839E-5
atypical teratoid / rhabdoid tumor 4369 7.67758782064047E-5
ulcerative colitis 2087 1.75703566131228E-4
pituitary cancer 1972 1.93479485050219E-4
pediatric high grade glioma 2712 2.8793311777633E-4
tuberculosis 1563 3.43519540511424E-4
glioblastoma 5572 4.8111345350268E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0204423771667528
diabetes mellitus 1663 0.0240075587543039
Breast cancer 3099 0.0244198241000972
spina bifida 1064 0.0331994072194255
Disease Target Count Z-score Confidence
Heart disease 279 0.0 2.0


  Differential Expression (13)

Disease log2 FC p
group 4 medulloblastoma 2.200 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.300 0.000
medulloblastoma, large-cell 2.000 0.000
tuberculosis -1.500 0.000
intraductal papillary-mucinous carcinoma... 1.200 0.020
diabetes mellitus -1.100 0.024
Breast cancer 4.100 0.024
pediatric high grade glioma 1.100 0.000
spina bifida -1.299 0.033
ulcerative colitis 1.200 0.000
pituitary cancer -1.100 0.000
psoriasis 1.400 0.000


Accession Q96KC2
Symbols ARL8




  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG

 GO Function (1)

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (6)

25496667 Genome-wide shRNA screening identifies ARL5B, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
22245584 Arl5b is a trans-golgi-network-localised small G protein that plays a key role in regulating transport along the endosome-trans-golgi network pathway
22172677 Arl8 and SKIP are required for lysosomes to distribute away from the microtubule-organizing center. We identify two kinesin light chain binding motifs in SKIP that are required for lysosomes to accumulate kinesin-1 and redistribute to the cell periphery.
20932310 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)
12853149 ARL8 contains six exons and five introns, and encodes a 179 amino acid protein that shares homology to the other ARL proteins.

AA Sequence

YLTLSSIKDHPWHIQSCCALTGEGLCQGLEWMTSRIGVR                                   141 - 179

Text Mined References (11)

PMID Year Title
22245584 2012 Arl5b is a Golgi-localised small G protein involved in the regulation of retrograde transport.
22172677 2011 Arl8 and SKIP act together to link lysosomes to kinesin-1.
21658281 2011 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.
20932310 2010 Genome-wide association reveals genetic effects on human A?42 and ? protein levels in cerebrospinal fluids: a case control study.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853149 2003 Isolation of a new member of the ADP-ribosylation like factor gene family, ARL8, from a cartilage cDNA library.