Property Summary

NCBI Gene PubMed Count 78
Grant Count 5
Funding $605,992.23
PubMed Score 51.79
PubTator Score 70.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (62)

PMID Text
26621837 Data suggest that single nucleotide polymorphisms (SNPs) in the telomerase (TERT)-cleft lip and palate transmembrane protein 1-like protein (CLPTM1L) locus may play a role in mediating the susceptibility to nasopharyngeal carcinoma (NPC) in Chinese.
26545403 CLPTM1L Polymorphism is associated with Nasopharyngeal Carcinoma.
25966219 rs2736100 on TERT-CLPTM1L indicates a poor prognosis for lung cancer in the Chinese Han population.
25526467 consumption of alcohol may interact with CLPTM1L polymorphisms to contribute to overall lung cancer susceptibility.
25487306 Using TCGA RNASeq data, we found significantly increased expression of both TERT and CLPTM1L in endometrial cancer tissue compared with normal tissue (TERT P = 1.5 x 10(-18), CLPTM1L P = 1.5 x 10(-19)).
25480402 miR-494 regulates cell growth, invasion and apoptosis of esophageal squamous cell carcinoma cells by targeting CLPTM1L.
25422207 This study showed that genetic variation rs31489 in 5p15.33 was directly associated with the reduced risk of lung cancer in Han Chinese. The CLPTM1L gene rs31489-A allele was a protective factor for the development of lung cancer only in nonsmokers.
25339005 Polymorphisms of CLPTM1L gene is associated with the risk of hepatocellular carcinoma.
25284078 This meta-analysis suggests that T allele of CLPTM1L-telomerase reverse transcriptase rs401681 polymorphism is associated with an increased PC risk, especially among Chinese.
25155038 CLPTM1L polymorphisms did not affect the tumor sensitivity to cisplatin combination chemotherapy in our study patients.
More...

AA Sequence

MWSGRSSFTSLVVGVFVVYVVHTCWVMYGIVYTRPCSGDANCIQPYLARRPKLQLSVYTTTRSHLGAENN      1 - 70
IDLVLNVEDFDVESKFERTVNVSVPKKTRNNGTLYAYIFLHHAGVLPWHDGKQVHLVSPLTTYMVPKPEE     71 - 140
INLLTGESDTQQIEAEKKPTSALDEPVSHWRPRLALNVMADNFVFDGSSLPADVHRYMKMIQLGKTVHYL    141 - 210
PILFIDQLSNRVKDLMVINRSTTELPLTVSYDKVSLGRLRFWIHMQDAVYSLQQFGFSEKDADEVKGIFV    211 - 280
DTNLYFLALTFFVAAFHLLFDFLAFKNDISFWKKKKSMIGMSTKAVLWRCFSTVVIFLFLLDEQTSLLVL    281 - 350
VPAGVGAAIELWKVKKALKMTIFWRGLMPEFQFGTYSESERKTEEYDTQAMKYLSYLLYPLCVGGAVYSL    351 - 420
LNIKYKSWYSWLINSFVNGVYAFGFLFMLPQLFVNYKLKSVAHLPWKAFTYKAFNTFIDDVFAFIITMPT    421 - 490
SHRLACFRDDVVFLVYLYQRWLYPVDKRRVNEFGESYEEKATRAPHTD                          491 - 538
//

Text Mined References (84)

PMID Year Title
26621837 2016 Common variations in TERT-CLPTM1L locus are reproducibly associated with the risk of nasopharyngeal carcinoma in Chinese populations.
26545403 2016 A GWAS Meta-analysis and Replication Study Identifies a Novel Locus within CLPTM1L/TERT Associated with Nasopharyngeal Carcinoma in Individuals of Chinese Ancestry.
26372813 2015 Genetic variations in the TERT and CLPTM1L gene region and gastrointestinal stromal tumors risk.
26064290 2015 CLPTM1L polymorphism and lung cancer risk.
25966219 2015 Association of genetic polymorphisms in TERT-CLPTM1L with lung cancer in a Chinese population.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25940397 2015 TERT gene harbors multiple variants associated with pancreatic cancer susceptibility.
25837821 2015 Inherited genetic variants associated with occurrence of multiple primary melanoma.
25526467 2014 CLPTM1L genetic polymorphisms and interaction with smoking and alcohol drinking in lung cancer risk: a case-control study in the Han population from northwest China.
25487306 2015 Candidate locus analysis of the TERT-CLPTM1L cancer risk region on chromosome 5p15 identifies multiple independent variants associated with endometrial cancer risk.
More...