Property Summary

NCBI Gene PubMed Count 84
PubMed Score 53.22
PubTator Score 70.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.163 3.2e-07
diabetes mellitus -1.100 3.7e-03
group 3 medulloblastoma 1.500 8.9e-04
juvenile dermatomyositis 1.153 2.5e-11
non primary Sjogren syndrome sicca 1.200 3.6e-02
ovarian cancer 3.200 1.1e-06
pancreatic ductal adenocarcinoma liver m... -1.858 1.4e-02

Gene RIF (68)

AA Sequence

MWSGRSSFTSLVVGVFVVYVVHTCWVMYGIVYTRPCSGDANCIQPYLARRPKLQLSVYTTTRSHLGAENN      1 - 70
IDLVLNVEDFDVESKFERTVNVSVPKKTRNNGTLYAYIFLHHAGVLPWHDGKQVHLVSPLTTYMVPKPEE     71 - 140
INLLTGESDTQQIEAEKKPTSALDEPVSHWRPRLALNVMADNFVFDGSSLPADVHRYMKMIQLGKTVHYL    141 - 210
PILFIDQLSNRVKDLMVINRSTTELPLTVSYDKVSLGRLRFWIHMQDAVYSLQQFGFSEKDADEVKGIFV    211 - 280
DTNLYFLALTFFVAAFHLLFDFLAFKNDISFWKKKKSMIGMSTKAVLWRCFSTVVIFLFLLDEQTSLLVL    281 - 350
VPAGVGAAIELWKVKKALKMTIFWRGLMPEFQFGTYSESERKTEEYDTQAMKYLSYLLYPLCVGGAVYSL    351 - 420
LNIKYKSWYSWLINSFVNGVYAFGFLFMLPQLFVNYKLKSVAHLPWKAFTYKAFNTFIDDVFAFIITMPT    421 - 490
SHRLACFRDDVVFLVYLYQRWLYPVDKRRVNEFGESYEEKATRAPHTD                          491 - 538
//

Text Mined References (90)

PMID Year Title