Property Summary

NCBI Gene PubMed Count 19
PubMed Score 40.40
PubTator Score 11.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute myeloid leukemia -1.400 3.1e-02
astrocytoma 1.100 6.4e-10
autosomal dominant Emery-Dreifuss muscul... 1.034 4.2e-03
Breast cancer -2.300 7.7e-10
breast carcinoma -1.100 8.9e-19
Duchenne muscular dystrophy 1.085 1.5e-07
head and neck cancer -1.500 1.5e-02
intraductal papillary-mucinous adenoma (... -1.500 3.6e-03
intraductal papillary-mucinous carcinoma... -1.400 7.8e-03
invasive ductal carcinoma -2.500 2.0e-04
juvenile dermatomyositis 1.101 1.9e-10
oligodendroglioma 1.200 2.5e-02
osteosarcoma -1.782 3.9e-02
ovarian cancer -1.900 1.2e-06
pancreatic cancer 1.100 2.4e-02
Pick disease 1.100 5.1e-05
pituitary cancer -2.800 4.6e-05
primary pancreatic ductal adenocarcinoma 1.131 2.3e-02
ulcerative colitis 1.100 8.1e-03

Protein-protein Interaction (1)

Gene RIF (11)

AA Sequence

MSRRKQAKPRSLKDPNCKLEDKTEDGEALDCKKRPEDGEELEDEAVHSCDSCLQVFESLSDITEHKINQC      1 - 70
QLTDGVDVEDDPTCSWPASSPSSKDQTSPSHGEGCDFGEEEGGPGLPYPCQFCDKSFSRLSYLKHHEQSH     71 - 140
SDKLPFKCTYCSRLFKHKRSRDRHIKLHTGDKKYHCSECDAAFSRSDHLKIHLKTHTSNKPYKCAICRRG    141 - 210
FLSSSSLHGHMQVHERNKDGSQSGSRMEDWKMKDTQKCSQCEEGFDFPEDLQKHIAECHPECSPNEDRAA    211 - 280
LQCVYCHELFVEETSLMNHMEQVHSGEKKNSCSICSESFHTVEELYSHMDSHQQPESCNHSNSPSLVTVG    281 - 350
YTSVSSTTPDSNLSVDSSTMVEAAPPIPKSRGRKRAAQQTPDMTGPSSKQAKVTYSCIYCNKQLFSSLAV    351 - 420
LQIHLKTMHLDKPEQAHICQYCLEVLPSLYNLNEHLKQVHEAQDPGLIVSAMPAIVYQCNFCSEVVNDLN    421 - 490
TLQEHIRCSHGFANPAAKDSNAFFCPHCYMGFLTDSSLEEHIRQVHCDLSGSRFGSPVLGTPKEPVVEVY    491 - 560
SCSYCTNSPIFNSVLKLNKHIKENHKNIPLALNYIHNGKKSRALSPLSPVAIEQTSLKMMQAVGGAPARP    561 - 630
TGEYICNQCGAKYTSLDSFQTHLKTHLDTVLPKLTCPQCNKEFPNQESLLKHVTIHFMITSTYYICESCD    631 - 700
KQFTSVDDLQKHLLDMHTFVFFRCTLCQEVFDSKVSIQLHLAVKHSNEKKVYRCTSCNWDFRNETDLQLH    701 - 770
VKHNHLENQGKVHKCIFCGESFGTEVELQCHITTHSKKYNCKFCSKAFHAIILLEKHLREKHCVFETKTP    771 - 840
NCGTNGASEQVQKEEVELQTLLTNSQESHNSHDGSEEDVDTSEPMYGCDICGAAYTMETLLQNHQLRDHN    841 - 910
IRPGESAIVKKKAELIKGNYKCNVCSRTFFSENGLREHMQTHLGPVKHYMCPICGERFPSLLTLTEHKVT    911 - 980
HSKSLDTGNCRICKMPLQSEEEFLEHCQMHPDLRNSLTGFRCVVCMQTVTSTLELKIHGTFHMQKTGNGS    981 - 1050
AVQTTGRGQHVQKLYKCASCLKEFRSKQDLVKLDINGLPYGLCAGCVNLSKSASPGINVPPGTNRPGLGQ   1051 - 1120
NENLSAIEGKGKVGGLKTRCSSCNVKFESESELQNHIQTIHRELVPDSNSTQLKTPQVSPMPRISPSQSD   1121 - 1190
EKKTYQCIKCQMVFYNEWDIQVHVANHMIDEGLNHECKLCSQTFDSPAKLQCHLIEHSFEGMGGTFKCPV   1191 - 1260
CFTVFVQANKLQQHIFSAHGQEDKIYDCTQCPQKFFFQTELQNHTMTQHSS                      1261 - 1311
//

Text Mined References (26)

PMID Year Title