Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.22
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.110 0.000
atypical teratoid / rhabdoid tumor 1.100 0.000
glioblastoma 1.100 0.000
medulloblastoma, large-cell 1.200 0.000
ovarian cancer -1.200 0.000

Gene RIF (2)

PMID Text
19240061 Observational study of gene-disease association. (HuGE Navigator)
18814840 ZC3H10 inhibits the anchorage independent growth of tumor cells, which is consistent with a tumor suppressor function.

AA Sequence

MPDRDSYANGTGSSGGGPGGGGSEEASGAGVGSGGASSDAICRDFLRNVCKRGKRCRYRHPDMSEVSNLG      1 - 70
VSKNEFIFCHDFQNKECSRPNCRFIHGSKEDEDGYKKTGELPPRLRQKVAAGLGLSPADLPNGKEEVPIC     71 - 140
RDFLKGDCQRGAKCKFRHLQRDFEFDARGGGGTGGGSTGSVLPGRRHDLYDIYDLPDRGFEDHEPGPKRR    141 - 210
RGGCCPPDGPHFESYEYSLAPPRGVECRLLEEENAMLRKRVEELKKQVSNLLATNEVLLEQNAQFRNQAK    211 - 280
VITLSSTAPATEQTLAPTVGTVATFNHGIAQTHTTLSSQALQPRPVSQQELVAPAGAPAAPPTNAAPPAA    281 - 350
PPPPPPHLTPEITPLSAALAQTIAQGMAPPPVSMAPVAVSVAPVAPVAVSMAQPLAGITMSHTTTPMVTY    351 - 420
PIASQSMRITAMPH                                                            421 - 434
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19060904 2009 An empirical framework for binary interactome mapping.
18814840 2008 Gene trapping identifies a putative tumor suppressor and a new inducer of cell migration.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...