Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.49
PubTator Score 1.60

Knowledge Summary

Patent (632)

Expression

  Differential Expression (3)

Disease log2 FC p
active Crohn's disease 3.086 7.5e-04
active ulcerative colitis 3.153 6.9e-03
intraductal papillary-mucinous neoplasm ... 1.900 9.7e-03

Gene RIF (1)

AA Sequence

MASCRAWNLRVLVAVVCGLLTGIILGLGIWRIVIRIQRGKSTSSSSTPTEFCRNGGTWENGRCICTEEWK      1 - 70
GLRCTIANFCENSTYMGFTFARIPVGRYGPSLQTCGKDTPNAGNPMAVRLCSLSLYGEIELQKVTIGNCN     71 - 140
ENLETLEKQVKDVTAPLNNISSEVQILTSDANKLTAENITSATRVVGQIFNTSRNASPEAKKVAIVTVSQ    141 - 210
LLDASEDAFQRVAATANDDALTTLIEQMETYSLSLGNQSVVEPNIAIQSANFSSENAVGPSNVRFSVQKG    211 - 280
ASSSLVSSSTFIHTNVDGLNPDAQTELQVLLNMTKNYTKTCGFVVYQNDKLFQSKTFTAKSDFSQKIISS    281 - 350
KTDENEQDQSASVDMVFSPKYNQKEFQLYSYACVYWNLSAKDWDTYGCQKDKGTDGFLRCRCNHTTNFAV    351 - 420
LMTFKKDYQYPKSLDILSNVGCALSVTGLALTVIFQIVTRKVRKTSVTWVLVNLCISMLIFNLLFVFGIE    421 - 490
NSNKNLQTSDGDINNIDFDNNDIPRTDTINIPNPMCTAIAALLHYFLLVTFTWNALSAAQLYYLLIRTMK    491 - 560
PLPRHFILFISLIGWGVPAIVVAITVGVIYSQNGNNPQWELDYRQEKICWLAIPEPNGVIKSPLLWSFIV    561 - 630
PVTIILISNVVMFITISIKVLWKNNQNLTSTKKVSSMKKIVSTLSVAVVFGITWILAYLMLVNDDSIRIV    631 - 700
FSYIFCLFNTTQGLQIFILYTVRTKVFQSEASKVLMLLSSIGRRKSLPSVTRPRLRVKMYNFLRSLPTLH    701 - 770
ERFRLLETSPSTEEITLSESDNAKESI                                               771 - 797
//

Text Mined References (11)

PMID Year Title