Property Summary

NCBI Gene PubMed Count 17
Grant Count 3
R01 Count 3
Funding $297,250.34
PubMed Score 5.85
PubTator Score 3.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Synonym

Accession Q96K76 B3KXF5 E9PM46 Q658U0 Q86Y73 Q8TEP6 Q9BWI0 Q9NWN1
Symbols TRFP

Gene

Gene RIF (7)

PMID Text
26169834 USP47 is a deubiquitinase that prevents beta-catenin ubiquitination.
26115687 these results suggest that USP47 may play distinct roles in ubiquitin-mediated cellular processes via de-ubiquitinating enzymes activity.
25429829 miR-204-5p acts as a tumor suppressor in gastric cancer through inhibiting USP47 and RAB22A.
25253721 Data indicate that E-cadherin ubiquitination consistently increases after depletion of kinesin-like protein KIFC3 or ubiquitin-specific protease USP47.
23904609 The results of this study indicated that USP47 plays a crucial role in the control of axonal growth during neuronal development by antagonizing CHIP-mediated katanin-p60 degradation.
21362556 USP47 has a role in regulating DNA repair and maintaining genome integrity
19966869 USP47, a novel beta-Trcp interactor, regulates cell growth and survival, potentially providing a novel target for anticancer therapies.

AA Sequence

MVPGEENQLVPKEDVFWRCRQNIFDEMKKKFLQIENAAEEPRVLCIIQDTTNSKTVNERITLNLPASTPV      1 - 70
RKLFEDVANKVGYINGTFDLVWGNGINTADMAPLDHTSDKSLLDANFEPGKKNFLHLTDKDGEQPQILLE     71 - 140
DSSAGEDSVHDRFIGPLPREGSGGSTSDYVSQSYSYSSILNKSETGYVGLVNQAMTCYLNSLLQTLFMTP    141 - 210
EFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVM    211 - 280
FDALEQKWKQTEQADLINELYQGKLKDYVRCLECGYEGWRIDTYLDIPLVIRPYGSSQAFASVEEALHAF    281 - 350
IQPEILDGPNQYFCERCKKKCDARKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSTF    351 - 420
IDVEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSNDDGVDEGICLETNSGTEKISKSGLEKNSLIYELF    421 - 490
SVMVHSGSAAGGHYYACIKSFSDEQWYSFNDQHVSRITQEDIKKTHGGSSGSRGYYSSAFASSTNAYMLI    491 - 560
YRLKDPARNAKFLEVDEYPEHIKNLVQKERELEEQEKRQREIERNTCKIKLFCLHPTKQVMMENKLEVHK    561 - 630
DKTLKEAVEMAYKMMDLEEVIPLDCCRLVKYDEFHDYLERSYEGEEDTPMGLLLGGVKSTYMFDLLLETR    631 - 700
KPDQVFQSYKPGEVMVKVHVVDLKAESVAAPITVRAYLNQTVTEFKQLISKAIHLPAETMRIVLERCYND    701 - 770
LRLLSVSSKTLKAEGFFRSNKVFVESSETLDYQMAFADSHLWKLLDRHANTIRLFVLLPEQSPVSYSKRT    771 - 840
AYQKAGGDSGNVDDDCERVKGPVGSLKSVEAILEESTEKLKSLSLQQQQDGDNGDSSKSTETSDFENIES    841 - 910
PLNERDSSASVDNRELEQHIQTSDPENFQSEERSDSDVNNDRSTSSVDSDILSSSHSSDTLCNADNAQIP    911 - 980
LANGLDSHSITSSRRTKANEGKKETWDTAEEDSGTDSEYDESGKSRGEMQYMYFKAEPYAADEGSGEGHK    981 - 1050
WLMVHVDKRITLAAFKQHLEPFVGVLSSHFKVFRVYASNQEFESVRLNETLSSFSDDNKITIRLGRALKK   1051 - 1120
GEYRVKVYQLLVNEQEPCKFLLDAVFAKGMTVRQSKEELIPQLREQCGLELSIDRFRLRKKTWKNPGTVF   1121 - 1190
LDYHIYEEDINISSNWEVFLEVLDGVEKMKSMSQLAVLSRRWKPSEMKLDPFQEVVLESSSVDELREKLS   1191 - 1260
EISGIPLDDIEFAKGRGTFPCDISVLDIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDE   1261 - 1330
QRNELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAPNKDLTQD                            1331 - 1375
//

Text Mined References (26)

PMID Year Title
26169834 2015 Deubiquitinase USP47/UBP64E Regulates ?-Catenin Ubiquitination and Degradation and Plays a Positive Role in Wnt Signaling.
26115687 2015 Expression, purification and enzymatic characterization of a recombinant human ubiquitin-specific protease 47.
25429829 2015 MicroRNA-204-5p inhibits gastric cancer cell proliferation by downregulating USP47 and RAB22A.
25416956 2014 A proteome-scale map of the human interactome network.
25253721 2014 Minus end-directed motor KIFC3 suppresses E-cadherin degradation by recruiting USP47 to adherens junctions.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23904609 2013 USP47 and C terminus of Hsp70-interacting protein (CHIP) antagonistically regulate katanin-p60-mediated axonal growth.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21362556 2011 USP47 is a deubiquitylating enzyme that regulates base excision repair by controlling steady-state levels of DNA polymerase ?.
21269460 2011 Initial characterization of the human central proteome.
More...