Property Summary

Ligand Count 5
NCBI Gene PubMed Count 17
PubMed Score 6.58
PubTator Score 3.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.100 2.2e-03
atypical teratoid / rhabdoid tumor -1.200 7.1e-03
ependymoma 1.200 1.0e-02
glioblastoma -1.400 2.8e-04
group 4 medulloblastoma 1.100 4.0e-03
inflammatory breast cancer -1.200 2.2e-04
intraductal papillary-mucinous adenoma (... 1.300 7.0e-03
invasive ductal carcinoma -1.300 2.1e-03
lung adenocarcinoma -1.300 1.1e-08
medulloblastoma, large-cell -1.100 9.7e-03
oligodendroglioma 1.100 3.1e-02
osteosarcoma -1.383 5.2e-04
ovarian cancer -1.300 9.2e-07
primary pancreatic ductal adenocarcinoma 1.044 9.1e-03
progressive supranuclear palsy -1.200 6.1e-03
Rheumatoid arthritis 1.400 3.9e-02
tuberculosis -1.300 1.5e-05

Gene RIF (7)

AA Sequence

MVPGEENQLVPKEDVFWRCRQNIFDEMKKKFLQIENAAEEPRVLCIIQDTTNSKTVNERITLNLPASTPV      1 - 70
RKLFEDVANKVGYINGTFDLVWGNGINTADMAPLDHTSDKSLLDANFEPGKKNFLHLTDKDGEQPQILLE     71 - 140
DSSAGEDSVHDRFIGPLPREGSGGSTSDYVSQSYSYSSILNKSETGYVGLVNQAMTCYLNSLLQTLFMTP    141 - 210
EFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVM    211 - 280
FDALEQKWKQTEQADLINELYQGKLKDYVRCLECGYEGWRIDTYLDIPLVIRPYGSSQAFASVEEALHAF    281 - 350
IQPEILDGPNQYFCERCKKKCDARKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSTF    351 - 420
IDVEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSNDDGVDEGICLETNSGTEKISKSGLEKNSLIYELF    421 - 490
SVMVHSGSAAGGHYYACIKSFSDEQWYSFNDQHVSRITQEDIKKTHGGSSGSRGYYSSAFASSTNAYMLI    491 - 560
YRLKDPARNAKFLEVDEYPEHIKNLVQKERELEEQEKRQREIERNTCKIKLFCLHPTKQVMMENKLEVHK    561 - 630
DKTLKEAVEMAYKMMDLEEVIPLDCCRLVKYDEFHDYLERSYEGEEDTPMGLLLGGVKSTYMFDLLLETR    631 - 700
KPDQVFQSYKPGEVMVKVHVVDLKAESVAAPITVRAYLNQTVTEFKQLISKAIHLPAETMRIVLERCYND    701 - 770
LRLLSVSSKTLKAEGFFRSNKVFVESSETLDYQMAFADSHLWKLLDRHANTIRLFVLLPEQSPVSYSKRT    771 - 840
AYQKAGGDSGNVDDDCERVKGPVGSLKSVEAILEESTEKLKSLSLQQQQDGDNGDSSKSTETSDFENIES    841 - 910
PLNERDSSASVDNRELEQHIQTSDPENFQSEERSDSDVNNDRSTSSVDSDILSSSHSSDTLCNADNAQIP    911 - 980
LANGLDSHSITSSRRTKANEGKKETWDTAEEDSGTDSEYDESGKSRGEMQYMYFKAEPYAADEGSGEGHK    981 - 1050
WLMVHVDKRITLAAFKQHLEPFVGVLSSHFKVFRVYASNQEFESVRLNETLSSFSDDNKITIRLGRALKK   1051 - 1120
GEYRVKVYQLLVNEQEPCKFLLDAVFAKGMTVRQSKEELIPQLREQCGLELSIDRFRLRKKTWKNPGTVF   1121 - 1190
LDYHIYEEDINISSNWEVFLEVLDGVEKMKSMSQLAVLSRRWKPSEMKLDPFQEVVLESSSVDELREKLS   1191 - 1260
EISGIPLDDIEFAKGRGTFPCDISVLDIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDE   1261 - 1330
QRNELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAPNKDLTQD                            1331 - 1375
//

Text Mined References (26)

PMID Year Title