Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.15
PubTator Score 1.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
ependymoma 4679 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 8.9e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.300 8.9e-05

Gene RIF (2)

AA Sequence

MEVEAAEARSPAPGYKRSGRRYKCVSCTKTFPNAPRAARHAATHGPADCSEEVAEVKPKPETEAKAEEAS      1 - 70
GEKVSGSAAKPRPYACPLCPKAYKTAPELRSHGRSHTGEKPFPCPECGRRFMQPVCLRVHLASHAGELPF     71 - 140
RCAHCPKAYGALSKLKIHQRGHTGERPYACADCGKSFADPSVFRKHRRTHAGLRPYSCERCGKAYAELKD    141 - 210
LRNHERSHTGERPFLCSECGKSFSRSSSLTCHQRIHAAQKPYRCPACGKGFTQLSSYQSHERTHSGEKPF    211 - 280
LCPRCGRMFSDPSSFRRHQRAHEGVKPYHCEKCGKDFRQPADLAMHRRVHTGDRPFKCLQCDKTFVASWD    281 - 350
LKRHALVHSGQRPFRCEECGRAFAERASLTKHSRVHSGERPFHCNACGKSFVVSSSLRKHERTHRSSEAA    351 - 420
GVPPAQELVVGLALPVGVAGESSAAPAAGAGLGDPPAGLLGLPPESGGVMATQWQVVGMTVEHVECQDAG    421 - 490
VREAPGPLEGAGEAGGEEADEKPPQFVCRECKETFSTMTLLRRHERSHPELRPFPCTQCGKSFSDRAGLR    491 - 560
KHSRTHSSVRPYTCPHCPKAFLSASDLRKHERTHPVPMGTPTPLEPLVALLGMPEEGPA               561 - 619
//

Text Mined References (12)

PMID Year Title