Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.33
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma -1.697 0.006
astrocytic glioma 1.800 0.006
ependymoma 2.100 0.001
oligodendroglioma 2.000 0.001
esophageal adenocarcinoma 1.200 0.020
psoriasis 1.300 0.000
osteosarcoma 3.235 0.000
adrenocortical carcinoma 1.017 0.001
pancreatic ductal adenocarcinoma liver m... 2.317 0.003
Breast cancer 2.400 0.028
non primary Sjogren syndrome sicca 1.100 0.025
Pick disease 1.300 0.000
ovarian cancer 1.700 0.000
cystic fibrosis and chronic rhinosinusit... 1.011 0.018

AA Sequence

MAAAAVGAGHGAGGPGAASSSGGAREGARVAALCLLWYALSAGGNVVNKVILSAFPFPVTVSLCHILALC      1 - 70
AGLPPLLRAWRVPPAPPVSGPGPSPHPSSGPLLPPRFYPRYVLPLAFGKYFASVSAHVSIWKVPVSYAHT     71 - 140
VKATMPIWVVLLSRIIMKEKQSTKVYLSLIPIISGVLLATVTELSFDMWGLVSALAATLCFSLQNIFSKK    141 - 210
VLRDSRIHHLRLLNILGCHAVFFMIPTWVLVDLSAFLVSSDLTYVYQWPWTLLLLAVSGFCNFAQNVIAF    211 - 280
SILNLVSPLSYSVANATKRIMVITVSLIMLRNPVTSTNVLGMMTAILGVFLYNKTKYDANQQARKHLLPV    281 - 350
TTADLSSKERHRSPLEKPHNGLLFPQHGDYQYGRNNILTDHFQYSRQSYPNSYSLNRYDV              351 - 410
//

Text Mined References (6)

PMID Year Title
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.