Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary


No data available


  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6


Gene RIF (1)

AA Sequence

EEFEDKWFRKIKDHFCPFENQFHTEIQILA                                            351 - 380

Text Mined References (7)

PMID Year Title