Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.79
PubTator Score 197.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3232 1.4e-05
ovarian cancer 8520 3.1e-05
osteosarcoma 7950 2.7e-04
psoriasis 6694 3.3e-04
astrocytic glioma 2597 2.6e-02
Disease Target Count Z-score Confidence
Anus cancer 6 3.452 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.100 2.6e-02
malignant mesothelioma 1.100 1.4e-05
osteosarcoma -1.186 2.7e-04
ovarian cancer 1.700 3.1e-05
psoriasis 2.400 3.3e-04

Gene RIF (4)

AA Sequence

MKTPVELAVSGMQTLGLQHRCRGGYRVKARTSYVDETLFGSPAGTRPTPPDFDPPWVEKANRTRGVGKEA      1 - 70
SKALGAKGSCETTPSRGSTPTLTPRKKNKYRPISHTPSYCDESLFGSRSEGASFGAPRMAKGDAAKLRAL     71 - 140
LWTPPPTPRGSHSPRPREAPLRAIHPAGPSKTEPGPAADSQKLSMGGLHSSRPLKRGLSHSLTHLNVPST    141 - 210
GHPATSAPHTNGPQDLRPSTSGVTFRSPLVTSRARSVSISVPSTPRRGGATQKPKPPWK               211 - 269
//

Text Mined References (18)

PMID Year Title