Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.68
PubTator Score 197.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
astrocytic glioma -1.100 0.026
psoriasis 2.400 0.000
osteosarcoma -1.186 0.000
ovarian cancer 1.700 0.000

Synonym

Accession Q96K30 B3KVZ4 C9JIN1 F8VRG5 Q53GM3 Q96K25
Symbols RITA
C12orf52

Gene

Gene RIF (3)

PMID Text
25588307 human RITA, binding to Drosophila Su(H) and tubulin, cannot influence the Notch signalling pathway in the fly
25445601 RITA overexpression increased expression of p53 and Fbxw7 and downregulated expression of cyclin D1, cyclin E, CDK2, Hes-1 and NF-kappaB p65. These changes led to growth inhibition and induced G0/G1 cell cycle arrest and apoptosis in SMMC7721 and HepG2 cells.
24308154 RITA might suppress tumor growth and induce apoptosis in hepatocellular carcinoma.

AA Sequence

MKTPVELAVSGMQTLGLQHRCRGGYRVKARTSYVDETLFGSPAGTRPTPPDFDPPWVEKANRTRGVGKEA      1 - 70
SKALGAKGSCETTPSRGSTPTLTPRKKNKYRPISHTPSYCDESLFGSRSEGASFGAPRMAKGDAAKLRAL     71 - 140
LWTPPPTPRGSHSPRPREAPLRAIHPAGPSKTEPGPAADSQKLSMGGLHSSRPLKRGLSHSLTHLNVPST    141 - 210
GHPATSAPHTNGPQDLRPSTSGVTFRSPLVTSRARSVSISVPSTPRRGGATQKPKPPWK               211 - 269
//

Text Mined References (17)

PMID Year Title
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25588307 2014 Analysis of the interaction between human RITA and Drosophila Suppressor of Hairless.
25445601 2014 RBP-J-interacting and tubulin-associated protein induces apoptosis and cell cycle arrest in human hepatocellular carcinoma by activating the p53-Fbxw7 pathway.
25416956 2014 A proteome-scale map of the human interactome network.
24308154 2013 RITA inhibits growth of human hepatocellular carcinoma through induction of apoptosis.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21102556 2011 RITA, a novel modulator of Notch signalling, acts via nuclear export of RBP-J.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...