Property Summary

NCBI Gene PubMed Count 12
PubMed Score 71.78
PubTator Score 6.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.576 8.5e-04
glioblastoma -1.200 1.0e-04
medulloblastoma, large-cell -1.100 3.3e-04
intraductal papillary-mucinous neoplasm ... 1.400 2.9e-03
ovarian cancer 1.400 8.1e-04

Gene RIF (4)

PMID Text
25882839 aberrant ubiquitination of substrates, or cellular adaptation to chronically reduced RNF170 levels likely accounts for the autosomal dominant sensory ataxia-associated Ca2+ signaling deficit
21610068 RNF170 plays an essential role in IP(3) receptor processing via the ubiquitin-proteasome pathway.
21115467 Together these results suggest that the mutation in RNF170 is causal for the sensory ataxia
18187620 Knockdown of ring finger protein 170 (RNF170) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MAKYQGEVQSLKLDDDSVIEGVSDQVLVAVVVSFALIATLVYALFRNVHQNIHPENQELVRVLREQLQTE      1 - 70
QDAPAATRQQFYTDMYCPICLHQASFPVETNCGHLFCGACIIAYWRYGSWLGAISCPICRQTVTLLLTVF     71 - 140
GEDDQSQDVLRLHQDINDYNRRFSGQPRSIMERIMDLPTLLRHAFREMFSVGGLFWMFRIRIILCLMGAF    141 - 210
FYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVITQRLTR                          211 - 258
//

Text Mined References (14)

PMID Year Title
25882839 2015 A Point Mutation in the Ubiquitin Ligase RNF170 That Causes Autosomal Dominant Sensory Ataxia Destabilizes the Protein and Impairs Inositol 1,4,5-Trisphosphate Receptor-mediated Ca2+ Signaling.
25416956 2014 A proteome-scale map of the human interactome network.
21610068 2011 RNF170 protein, an endoplasmic reticulum membrane ubiquitin ligase, mediates inositol 1,4,5-trisphosphate receptor ubiquitination and degradation.
21269460 2011 Initial characterization of the human central proteome.
21115467 2011 A mutation in the RNF170 gene causes autosomal dominant sensory ataxia.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15286160 2004 A novel neurodegenerative disease characterised by posterior column ataxia and pyramidal tract involvement maps to chromosome 8p12-8q12.1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.