Property Summary

NCBI Gene PubMed Count 12
Grant Count 7
R01 Count 5
Funding $2,010,216.5
PubMed Score 71.78
PubTator Score 6.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.576 0.001
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.100 0.000
intraductal papillary-mucinous neoplasm ... 1.400 0.003
ovarian cancer 1.400 0.001

Gene RIF (4)

PMID Text
25882839 aberrant ubiquitination of substrates, or cellular adaptation to chronically reduced RNF170 levels likely accounts for the autosomal dominant sensory ataxia-associated Ca2+ signaling deficit
21610068 RNF170 plays an essential role in IP(3) receptor processing via the ubiquitin-proteasome pathway.
21115467 Together these results suggest that the mutation in RNF170 is causal for the sensory ataxia
18187620 Knockdown of ring finger protein 170 (RNF170) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MAKYQGEVQSLKLDDDSVIEGVSDQVLVAVVVSFALIATLVYALFRNVHQNIHPENQELVRVLREQLQTE      1 - 70
QDAPAATRQQFYTDMYCPICLHQASFPVETNCGHLFCGACIIAYWRYGSWLGAISCPICRQTVTLLLTVF     71 - 140
GEDDQSQDVLRLHQDINDYNRRFSGQPRSIMERIMDLPTLLRHAFREMFSVGGLFWMFRIRIILCLMGAF    141 - 210
FYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVITQRLTR                          211 - 258
//

Text Mined References (14)

PMID Year Title
25882839 2015 A Point Mutation in the Ubiquitin Ligase RNF170 That Causes Autosomal Dominant Sensory Ataxia Destabilizes the Protein and Impairs Inositol 1,4,5-Trisphosphate Receptor-mediated Ca2+ Signaling.
25416956 2014 A proteome-scale map of the human interactome network.
21610068 2011 RNF170 protein, an endoplasmic reticulum membrane ubiquitin ligase, mediates inositol 1,4,5-trisphosphate receptor ubiquitination and degradation.
21269460 2011 Initial characterization of the human central proteome.
21115467 2011 A mutation in the RNF170 gene causes autosomal dominant sensory ataxia.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15286160 2004 A novel neurodegenerative disease characterised by posterior column ataxia and pyramidal tract involvement maps to chromosome 8p12-8q12.1.
More...