Property Summary

NCBI Gene PubMed Count 11
PubMed Score 13.36
PubTator Score 5.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
pancreatic cancer 1.200 0.002
astrocytic glioma -2.400 0.001
ependymoma -2.700 0.002
oligodendroglioma -2.600 0.002
esophageal adenocarcinoma 1.200 0.020
psoriasis -2.400 0.000
osteosarcoma -2.899 0.007
group 4 medulloblastoma -2.900 0.000
atypical teratoid / rhabdoid tumor -2.700 0.000
glioblastoma -1.700 0.007
medulloblastoma, large-cell -3.600 0.000
primitive neuroectodermal tumor -1.600 0.032
Atopic dermatitis -2.400 0.016
tuberculosis 2.400 0.000
non-small cell lung cancer -1.843 0.000
intraductal papillary-mucinous adenoma (... 1.300 0.030
intraductal papillary-mucinous carcinoma... 2.900 0.017
intraductal papillary-mucinous neoplasm ... 4.200 0.001
lung cancer -1.200 0.050
interstitial cystitis 1.500 0.000
cystic fibrosis 1.100 0.001
lung adenocarcinoma -1.400 0.000
pancreatic carcinoma 1.200 0.002
lung carcinoma -2.000 0.000
Pick disease -1.100 0.001
Breast cancer 1.600 0.001

Synonym

Accession Q96K12 F8VV73 Q9H0D5 Q9NVW8
Symbols MLSTD1
SDR10E2
HEL-S-81

Gene

 GWAS Trait (1)

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15220349 wax monoester synthesis in mammals involves a two step biosynthetic pathway catalyzed by fatty acyl-CoA reductase and wax synthase enzymes
15220348 fatty alcohol synthesis in mammals is accomplished by two fatty acyl-CoA reductase isozymes that are expressed at high levels in tissues known to synthesize wax monoesters and ether lipids

AA Sequence

MSTIAAFYGGKSILITGATGFLGKVLMEKLFRTSPDLKVIYILVRPKAGQTLQQRVFQILDSKLFEKVKE      1 - 70
VCPNVHEKIRAIYADLNQNDFAISKEDMQELLSCTNIIFHCAATVRFDDTLRHAVQLNVTATRQLLLMAS     71 - 140
QMPKLEAFIHISTAYSNCNLKHIDEVIYPCPVEPKKIIDSLEWLDDAIIDEITPKLIRDWPNIYTYTKAL    141 - 210
GEMVVQQESRNLNIAIIRPSIVGATWQEPFPGWVDNINGPNGIIIATGKGFLRAIKATPMAVADVIPVDT    211 - 280
VVNLMLAVGWYTAVHRPKSTLVYHITSGNMNPCNWHKMGVQVLATFEKIPFERPFRRPNANFTSNSFTSQ    281 - 350
YWNAVSHRAPAIIYDCYLRLTGRKPRMTKLMNRLLRTVSMLEYFINRSWEWSTYNTEMLMSELSPEDQRV    351 - 420
FNFDVRQLNWLEYIENYVLGVKKYLLKEDMAGIPKAKQRLKRLRNIHYLFNTALFLIAWRLLIARSQMAR    421 - 490
NVWFFIVSFCYKFLSYFRASSTLKV                                                 491 - 515
//

Text Mined References (12)

PMID Year Title
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
16756494 2006 Biochemistry of mammalian peroxisomes revisited.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15220349 2004 Mammalian wax biosynthesis. II. Expression cloning of wax synthase cDNAs encoding a member of the acyltransferase enzyme family.
15220348 2004 Mammalian wax biosynthesis. I. Identification of two fatty acyl-Coenzyme A reductases with different substrate specificities and tissue distributions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...