Property Summary

NCBI Gene PubMed Count 11
PubMed Score 13.36
PubTator Score 5.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Platelet mean volume finding 31
Disease Target Count P-value
lung carcinoma 2844 2.45108115012993E-18
non-small cell lung cancer 2798 1.23330963590824E-15
psoriasis 6685 6.87085185326313E-15
lung adenocarcinoma 2714 2.4924568440745E-11
medulloblastoma, large-cell 6234 1.37384364498542E-6
tuberculosis 1563 1.51224296806424E-6
group 4 medulloblastoma 1875 6.52660996867161E-6
atypical teratoid / rhabdoid tumor 4369 6.76618393141019E-6
interstitial cystitis 2299 9.29101058578052E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 5.23837628980594E-4
Pick disease 1893 7.45090382097483E-4
Breast cancer 3099 9.13191191403505E-4
cystic fibrosis 1670 0.00129115776605927
astrocytic glioma 2241 0.0014654043068931
oligodendroglioma 2849 0.0017451772937286
pancreatic carcinoma 567 0.00175140997219755
pancreatic cancer 2300 0.00175140997219756
ependymoma 2514 0.00221407736617953
glioblastoma 5572 0.00680559265953705
osteosarcoma 7933 0.00735416670637677
Atopic dermatitis 944 0.0161957583115993
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0167312301442957
esophageal adenocarcinoma 737 0.0200915747929482
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0298290733646109
primitive neuroectodermal tumor 3031 0.0324808457598667
lung cancer 4473 0.0497713254529572
Disease Target Count Z-score Confidence
Extrahepatic bile duct carcinoma 2 3.781 1.9

Expression

  Differential Expression (26)

Disease log2 FC p
pancreatic cancer 1.200 0.002
astrocytic glioma -2.400 0.001
ependymoma -2.700 0.002
oligodendroglioma -2.600 0.002
esophageal adenocarcinoma 1.200 0.020
psoriasis -2.400 0.000
osteosarcoma -2.899 0.007
group 4 medulloblastoma -2.900 0.000
atypical teratoid / rhabdoid tumor -2.700 0.000
glioblastoma -1.700 0.007
medulloblastoma, large-cell -3.600 0.000
primitive neuroectodermal tumor -1.600 0.032
Atopic dermatitis -2.400 0.016
tuberculosis 2.400 0.000
non-small cell lung cancer -1.843 0.000
intraductal papillary-mucinous adenoma (... 1.300 0.030
intraductal papillary-mucinous carcinoma... 2.900 0.017
intraductal papillary-mucinous neoplasm ... 4.200 0.001
lung cancer -1.200 0.050
interstitial cystitis 1.500 0.000
cystic fibrosis 1.100 0.001
lung adenocarcinoma -1.400 0.000
pancreatic carcinoma 1.200 0.002
lung carcinoma -2.000 0.000
Pick disease -1.100 0.001
Breast cancer 1.600 0.001

Synonym

Accession Q96K12 F8VV73 Q9H0D5 Q9NVW8
Symbols MLSTD1
SDR10E2
HEL-S-81

Gene

  Ortholog (8)

 GWAS Trait (1)

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15220349 wax monoester synthesis in mammals involves a two step biosynthetic pathway catalyzed by fatty acyl-CoA reductase and wax synthase enzymes
15220348 fatty alcohol synthesis in mammals is accomplished by two fatty acyl-CoA reductase isozymes that are expressed at high levels in tissues known to synthesize wax monoesters and ether lipids

AA Sequence

MSTIAAFYGGKSILITGATGFLGKVLMEKLFRTSPDLKVIYILVRPKAGQTLQQRVFQILDSKLFEKVKE      1 - 70
VCPNVHEKIRAIYADLNQNDFAISKEDMQELLSCTNIIFHCAATVRFDDTLRHAVQLNVTATRQLLLMAS     71 - 140
QMPKLEAFIHISTAYSNCNLKHIDEVIYPCPVEPKKIIDSLEWLDDAIIDEITPKLIRDWPNIYTYTKAL    141 - 210
GEMVVQQESRNLNIAIIRPSIVGATWQEPFPGWVDNINGPNGIIIATGKGFLRAIKATPMAVADVIPVDT    211 - 280
VVNLMLAVGWYTAVHRPKSTLVYHITSGNMNPCNWHKMGVQVLATFEKIPFERPFRRPNANFTSNSFTSQ    281 - 350
YWNAVSHRAPAIIYDCYLRLTGRKPRMTKLMNRLLRTVSMLEYFINRSWEWSTYNTEMLMSELSPEDQRV    351 - 420
FNFDVRQLNWLEYIENYVLGVKKYLLKEDMAGIPKAKQRLKRLRNIHYLFNTALFLIAWRLLIARSQMAR    421 - 490
NVWFFIVSFCYKFLSYFRASSTLKV                                                 491 - 515
//

Text Mined References (12)

PMID Year Title
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
16756494 2006 Biochemistry of mammalian peroxisomes revisited.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15220349 2004 Mammalian wax biosynthesis. II. Expression cloning of wax synthase cDNAs encoding a member of the acyltransferase enzyme family.
15220348 2004 Mammalian wax biosynthesis. I. Identification of two fatty acyl-Coenzyme A reductases with different substrate specificities and tissue distributions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...