Property Summary

NCBI Gene PubMed Count 12
PubMed Score 12.48
PubTator Score 5.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
astrocytic glioma -1.900 1.1e-03
Atopic dermatitis -1.900 2.4e-02
atypical teratoid / rhabdoid tumor -1.500 3.3e-03
Breast cancer 1.600 9.1e-04
cystic fibrosis 1.100 1.3e-03
ependymoma -2.300 5.0e-04
esophageal adenocarcinoma 1.200 2.0e-02
glioblastoma -1.700 6.8e-03
group 3 medulloblastoma -1.800 7.0e-03
interstitial cystitis 1.500 9.3e-05
intraductal papillary-mucinous adenoma (... 1.300 3.0e-02
intraductal papillary-mucinous carcinoma... 2.100 2.6e-02
intraductal papillary-mucinous neoplasm ... 2.600 4.8e-04
lung adenocarcinoma -1.200 2.2e-08
lung cancer -1.200 5.0e-02
lung carcinoma -2.000 2.5e-18
medulloblastoma, large-cell -2.100 1.1e-03
non-small cell lung cancer -1.675 2.1e-13
oligodendroglioma -2.200 6.5e-04
osteosarcoma -1.641 4.7e-02
pancreatic cancer 1.200 1.8e-03
pancreatic carcinoma 1.200 1.8e-03
Pick disease -1.100 7.5e-04
primitive neuroectodermal tumor -1.300 4.7e-02
psoriasis -2.300 3.6e-04
tuberculosis 2.200 4.2e-06

Gene RIF (3)

AA Sequence

MSTIAAFYGGKSILITGATGFLGKVLMEKLFRTSPDLKVIYILVRPKAGQTLQQRVFQILDSKLFEKVKE      1 - 70
VCPNVHEKIRAIYADLNQNDFAISKEDMQELLSCTNIIFHCAATVRFDDTLRHAVQLNVTATRQLLLMAS     71 - 140
QMPKLEAFIHISTAYSNCNLKHIDEVIYPCPVEPKKIIDSLEWLDDAIIDEITPKLIRDWPNIYTYTKAL    141 - 210
GEMVVQQESRNLNIAIIRPSIVGATWQEPFPGWVDNINGPNGIIIATGKGFLRAIKATPMAVADVIPVDT    211 - 280
VVNLMLAVGWYTAVHRPKSTLVYHITSGNMNPCNWHKMGVQVLATFEKIPFERPFRRPNANFTSNSFTSQ    281 - 350
YWNAVSHRAPAIIYDCYLRLTGRKPRMTKLMNRLLRTVSMLEYFINRSWEWSTYNTEMLMSELSPEDQRV    351 - 420
FNFDVRQLNWLEYIENYVLGVKKYLLKEDMAGIPKAKQRLKRLRNIHYLFNTALFLIAWRLLIARSQMAR    421 - 490
NVWFFIVSFCYKFLSYFRASSTLKV                                                 491 - 515
//

Text Mined References (13)

PMID Year Title