Property Summary

NCBI Gene PubMed Count 27
PubMed Score 265.16
PubTator Score 17.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease -1.344 6.6e-03
acute quadriplegic myopathy -1.119 6.8e-05
Astrocytoma, Pilocytic 1.200 4.7e-04
Barrett's esophagus -1.100 3.6e-02
cystic fibrosis -1.018 3.4e-05
esophageal adenocarcinoma -2.200 1.8e-02
gastric carcinoma 1.700 6.7e-03
group 4 medulloblastoma -1.600 2.7e-03
head and neck cancer -1.100 2.4e-03
medulloblastoma, large-cell -2.000 1.4e-03
non-small cell lung cancer -1.822 1.1e-26
ovarian cancer -1.800 6.2e-09
pancreatic cancer 1.100 1.0e-02
primary pancreatic ductal adenocarcinoma 1.016 8.7e-03
tuberculosis 2.000 7.4e-09
ulcerative colitis -1.500 1.8e-05

Gene RIF (16)

AA Sequence

MALTVDVAGPAPWGFRITGGRDFHTPIMVTKVAERGKAKDADLRPGDIIVAINGESAEGMLHAEAQSKIR      1 - 70
QSPSPLRLQLDRSQATSPGQTNGDSSLEVLATRFQGSVRTYTESQSSLRSSYSSPTSLSPRAGSPFSPPP     71 - 140
SSSSLTGEAAISRSFQSLACSPGLPAADRLSYSGRPGSRQAGLGRAGDSAVLVLPPSPGPRSSRPSMDSE    141 - 210
GGSLLLDEDSEVFKMLQENREGRAAPRQSSSFRLLQEALEAEERGGTPAFLPSSLSPQSSLPASRALATP    211 - 280
PKLHTCEKCSTSIANQAVRIQEGRYRHPGCYTCADCGLNLKMRGHFWVGDELYCEKHARQRYSAPATLSS    281 - 350
RA                                                                        351 - 352
//

Text Mined References (30)

PMID Year Title