Property Summary

NCBI Gene PubMed Count 23
Grant Count 7
R01 Count 3
Funding $909,724.69
PubMed Score 261.22
PubTator Score 17.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Barrett's esophagus -1.100 0.036
esophageal adenocarcinoma -2.200 0.018
cystic fibrosis -1.018 0.000
medulloblastoma, large-cell -2.000 0.001
acute quadriplegic myopathy -1.119 0.000
tuberculosis 2.000 0.000
primary pancreatic ductal adenocarcinoma 1.016 0.009
non-small cell lung cancer -1.822 0.000
active Crohn's disease -1.344 0.007
group 4 medulloblastoma -1.600 0.003
pilocytic astrocytoma 1.200 0.000
gastric carcinoma 1.700 0.007
ulcerative colitis -1.500 0.000
ovarian cancer 2.100 0.000
pancreatic cancer 1.100 0.010
head and neck cancer -1.100 0.002

Gene RIF (12)

PMID Text
26499308 The suppression of PDLIM2 expression significantly reduced cell proliferation, cell growth and neoplasm invasiveness in prostate cancer cells.
25681443 epigenetic repression of PDLIM2 can be reversed by 5-aza-2-deoxycytidine and vitamin D to suppress KSHV-associated cancer cell growth
24863845 PDLIM2 expression is essential for feedback regulation of the beta1-integrin-RhoA signalling axis and integration of cellular microenvironment signals with gene expression to control the polarity of breast epithelial acini structures.
24196835 PDLIM2 integrates cytoskeleton signaling with gene expression in epithelial differentiation by controlling the stability of key transcription factors and COP9 signalosome activity.
23584482 PDLIM2 was a direct target gene of 1,25(OH)2D3
21814175 Pdlim2 is a novel actin-regulating protein of podocyte foot processes that may have a role in the pathogenesis of glomerular diseases.
20838382 PDLIM2 binds to Tax directly, which was mediated by a putative alpa-helix motif of PDLIM2 at amino acids 236-254.
20185823 PDLIM2, an essential terminator of NF-kappaB activation, is repressed in both estrogen receptor-positive and estrogen receptor-negative breast cancer cells, suggesting one important mechanism for the constitutive activation of NF-kappaB.
19794962 Data show that the PDLIM2 repression was independent of the viral regulatory protein Tax because neither short-term induction nor long-term stable expression of Tax could downregulate PDLIM2 expression.
19052146 Suppression of PDLIM2 expression resulted in decreased cell adhesion, increased NF-kappaB transcription reporter activity, and increased LPS-induced TNF-alpha production.
More...

AA Sequence

MALTVDVAGPAPWGFRITGGRDFHTPIMVTKVAERGKAKDADLRPGDIIVAINGESAEGMLHAEAQSKIR      1 - 70
QSPSPLRLQLDRSQATSPGQTNGDSSLEVLATRFQGSVRTYTESQSSLRSSYSSPTSLSPRAGSPFSPPP     71 - 140
SSSSLTGEAAISRSFQSLACSPGLPAADRLSYSGRPGSRQAGLGRAGDSAVLVLPPSPGPRSSRPSMDSE    141 - 210
GGSLLLDEDSEVFKMLQENREGRAAPRQSSSFRLLQEALEAEERGGTPAFLPSSLSPQSSLPASRALATP    211 - 280
PKLHTCEKCSTSIANQAVRIQEGRYRHPGCYTCADCGLNLKMRGHFWVGDELYCEKHARQRYSAPATLSS    281 - 350
RA                                                                        351 - 352
//

Text Mined References (26)

PMID Year Title
26499308 2016 PDLIM2 suppression efficiently reduces tumor growth and invasiveness of human castration-resistant prostate cancer-like cells.
25681443 2015 Oncovirus Kaposi sarcoma herpesvirus (KSHV) represses tumor suppressor PDLIM2 to persistently activate nuclear factor ?B (NF-?B) and STAT3 transcription factors for tumorigenesis and tumor maintenance.
24863845 2014 Essential function for PDLIM2 in cell polarization in three-dimensional cultures by feedback regulation of the ?1-integrin-RhoA signaling axis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24196835 2014 PDLIM2 regulates transcription factor activity in epithelial-to-mesenchymal transition via the COP9 signalosome.
23584482 2014 PDLIM2 expression is driven by vitamin D and is involved in the pro-adhesion, and anti-migration and -invasion activity of vitamin D.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21814175 2011 Pdlim2 is a novel actin-regulating protein of podocyte foot processes.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20838382 2010 Molecular determinants of PDLIM2 in suppressing HTLV-I Tax-mediated tumorigenesis.
More...