Property Summary

NCBI Gene PubMed Count 16
PubMed Score 30.09
PubTator Score 10.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.700 5.5e-03
glioblastoma -1.300 7.7e-03
group 3 medulloblastoma -2.400 1.2e-04
medulloblastoma, large-cell -2.300 1.7e-04
oligodendroglioma -1.600 7.2e-03
primitive neuroectodermal tumor -1.800 1.9e-03

Gene RIF (8)

AA Sequence

MPNRKASRNAYYFFVQEKIPELRRRGLPVARVADAIPYCSSDWALLREEEKEKYAEMAREWRAAQGKDPG      1 - 70
PSEKQKPVFTPLRRPGMLVPKQNVSPPDMSALSLKGDQALLGGIFYFLNIFSHGELPPHCEQRFLPCEIG     71 - 140
CVKYSLQEGIMADFHSFINPGEIPRGFRFHCQAASDSSHKIPISNFERGHNQATVLQNLYRFIHPNPGNW    141 - 210
PPIYCKSDDRTRVNWCLKHMAKASEIRQDLQLLTVEDLVVGIYQQKFLKEPSKTWIRSLLDVAMWDYSSN    211 - 280
TRCKWHEENDILFCALAVCKKIAYCISNSLATLFGIQLTEAHVPLQDYEASNSVTPKMVVLDAGRYQKLR    281 - 350
VGSSGFSHFNSSNEEQRSNTPIGDYPSRAKISGQNSSVRGRGITRLLESISNSSSNIHKFSNCDTSLSPY    351 - 420
MSQKDGYKSFSSLS                                                            421 - 434
//

Text Mined References (17)

PMID Year Title