Property Summary

NCBI Gene PubMed Count 14
PubMed Score 28.05
PubTator Score 10.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.700 0.006
oligodendroglioma -1.600 0.007
group 3 medulloblastoma -2.400 0.000
glioblastoma -1.300 0.008
medulloblastoma, large-cell -2.300 0.000
primitive neuroectodermal tumor -1.800 0.002

Synonym

Accession Q96JY0 B4DY43 E9JVC3 Q49AP9 Q5VZP8 Q9UIW6
Symbols CT128
SPATA35

Gene

PDB

2CTO  

Gene RIF (6)

PMID Text
24189637 Immunofluorescence analysis showed that MAEL co-localizes with the stress granule marker PABPC1 in stress granules during oxidative stress. MAEL may be involved in miRNA-mediated gene silencing in SGs.
23929794 Maelstrom promotes hepatocellular carcinoma metastasis by inducing epithelial-mesenchymal transition by way of Akt/GSK-3beta/Snail signaling.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19693694 These results suggest that MAEL is a novel cancer/testis-associated gene and is regulated by DNA methylation.
19536175 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPNRKASRNAYYFFVQEKIPELRRRGLPVARVADAIPYCSSDWALLREEEKEKYAEMAREWRAAQGKDPG      1 - 70
PSEKQKPVFTPLRRPGMLVPKQNVSPPDMSALSLKGDQALLGGIFYFLNIFSHGELPPHCEQRFLPCEIG     71 - 140
CVKYSLQEGIMADFHSFINPGEIPRGFRFHCQAASDSSHKIPISNFERGHNQATVLQNLYRFIHPNPGNW    141 - 210
PPIYCKSDDRTRVNWCLKHMAKASEIRQDLQLLTVEDLVVGIYQQKFLKEPSKTWIRSLLDVAMWDYSSN    211 - 280
TRCKWHEENDILFCALAVCKKIAYCISNSLATLFGIQLTEAHVPLQDYEASNSVTPKMVVLDAGRYQKLR    281 - 350
VGSSGFSHFNSSNEEQRSNTPIGDYPSRAKISGQNSSVRGRGITRLLESISNSSSNIHKFSNCDTSLSPY    351 - 420
MSQKDGYKSFSSLS                                                            421 - 434
//

Text Mined References (15)

PMID Year Title
25367360 2015 Genome-wide association study for refractive astigmatism reveals genetic co-determination with spherical equivalent refractive error: the CREAM consortium.
24189637 2014 Proteomic analysis reveals that MAEL, a component of nuage, interacts with stress granule proteins in cancer cells.
23929794 2014 Maelstrom promotes hepatocellular carcinoma metastasis by inducing epithelial-mesenchymal transition by way of Akt/GSK-3?/Snail signaling.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19693694 2010 Identification of a novel human cancer/testis gene MAEL that is regulated by DNA methylation.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
18694567 2008 Mouse maelstrom, a component of nuage, is essential for spermatogenesis and transposon repression in meiosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...