Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.40
PubTator Score 1.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
aldosterone-producing adenoma -1.170 6.9e-03
astrocytic glioma -1.800 2.0e-02
cystic fibrosis -1.100 2.9e-03
ependymoma -1.700 4.0e-02
glioblastoma 1.100 2.6e-06
group 4 medulloblastoma -1.500 1.0e-03
interstitial cystitis 1.600 3.7e-03
intraductal papillary-mucinous adenoma (... 2.000 2.3e-03
intraductal papillary-mucinous neoplasm ... 1.500 2.8e-02
medulloblastoma, large-cell -2.300 1.8e-06
oligodendroglioma -1.700 3.2e-02
ovarian cancer -1.900 6.1e-07
pancreatic ductal adenocarcinoma liver m... -1.668 5.1e-03
pediatric high grade glioma 1.200 6.2e-05
tuberculosis -2.000 3.2e-05

AA Sequence

MTNSKGRSITDKTSGGPSSGGGFVDWTLRLNTIQSDKFLNLLLSMVPVIYQKNQEDRHKKANGIWQDGLS      1 - 70
TAVQTFSNRSEQHMEYHSFSEQSFHANNGHASSSCSQKYDDYANYNYCDGRETSETTAMLQDEDISSDGD     71 - 140
EDAIVEVTPKLPKESSGIMALQILVPFLLAGFGTVSAGMVLDIVQHWEVFRKVTEVFILVPALLGLKGNL    141 - 210
EMTLASRLSTAVNIGKMDSPIEKWNLIIGNLALKQVQATVVGFLAAVAAIILGWIPEGKYYLDHSILLCS    211 - 280
SSVATAFIASLLQGIIMVGVIVGSKKTGINPDNVATPIAASFGDLITLAILAWISQGLYSCLETYYYISP    281 - 350
LVGVFFLALTPIWIIIAAKHPATRTVLHSGWEPVITAMVISSIGGLILDTTVSDPNLVGIVVYTPVINGI    351 - 420
GGNLVAIQASRISTYLHLHSIPGELPDEPKGCYYPFRTFFGPGVNNKSAQVLLLLVIPGHLIFLYTIHLM    421 - 490
KSGHTSLTIIFIVVYLFGAVLQVFTLLWIADWMVHHFWRKGKDPDSFSIPYLTALGDLLGTALLALSFHF    491 - 560
LWLIGDRDGDVGD                                                             561 - 573
//

Text Mined References (10)

PMID Year Title