Property Summary

NCBI Gene PubMed Count 22
Grant Count 16
R01 Count 10
Funding $739,953.82
PubMed Score 33.50
PubTator Score 32.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.178 0.000
pancreatic cancer 1.200 0.000
pituitary cancer -1.600 0.000

Gene RIF (14)

PMID Text
26938874 CTCF has a role in regulating SLC45A3-ELK4 Chimeric RNA
25434496 genome-wide association studies show that the top SNP associated with log PSA 9Prostate-specific antigen) levels was rs2153904 in SLC45A3.
23269536 Genome-wide association study identified novel genetic variant on SLC45A3 gene associated with serum levels prostate-specific antigen (PSA) in a Chinese population.
22821757 This study provides first evidence that the expression of SLC45A3 protein is down regulated through SLC45A3-ERG fusion in prostate cancer.
22719019 Data suggest that chimeric SLC45A3-ELK4 controls prostate cancer cell proliferation, and the chimera level correlates with prostate cancer disease progression.
21777423 Double sequential immunohistochemical staining with p63 and P501S is highly specific and can be a useful tool in distinguishing urothelial carcinoma from prostate carcinoma.
20118910 This is the first study to report concurrent TMPRSS2 and SLC45A3 rearrangements in the same tumor focus in prostate cancer
19649210 This study demonstrates that most ERG-overexpressing prostate cancers harbor hormonally regulated TMPRSS2-ERG, SLC45A3-ERG, or NDRG1-ERG fusions
19136943 SLC45A3-ELK4 may represent the first description of a recurrent RNA chimaeric transcript specific to prostate cancer that does not have a detectable DNA aberration
18193184 Intronic miRNAs from tissue-specific transcripts, or their natural absence, make cardinal contributions to cellular gene expression and phenotype.
More...

AA Sequence

MVQRLWVSRLLRHRKAQLLLVNLLTFGLEVCLAAGITYVPPLLLEVGVEEKFMTMVLGIGPVLGLVCVPL      1 - 70
LGSASDHWRGRYGRRRPFIWALSLGILLSLFLIPRAGWLAGLLCPDPRPLELALLILGVGLLDFCGQVCF     71 - 140
TPLEALLSDLFRDPDHCRQAYSVYAFMISLGGCLGYLLPAIDWDTSALAPYLGTQEECLFGLLTLIFLTC    141 - 210
VAATLLVAEEAALGPTEPAEGLSAPSLSPHCCPCRARLAFRNLGALLPRLHQLCCRMPRTLRRLFVAELC    211 - 280
SWMALMTFTLFYTDFVGEGLYQGVPRAEPGTEARRHYDEGVRMGSLGLFLQCAISLVFSLVMDRLVQRFG    281 - 350
TRAVYLASVAAFPVAAGATCLSHSVAVVTASAALTGFTFSALQILPYTLASLYHREKQVFLPKYRGDTGG    351 - 420
ASSEDSLMTSFLPGPKPGAPFPNGHVGAGGSGLLPPPPALCGASACDVSVRVVVGEPTEARVVPGRGICL    421 - 490
DLAILDSAFLLSQVAPSLFMGSIVQLSQSVTAYMVSAAGLGLVAIYFATQVVFDKSDLAKYSA           491 - 553
//

Text Mined References (23)

PMID Year Title
26938874 2016 Role of CTCF in Regulating SLC45A3-ELK4 Chimeric RNA.
25434496 2015 Genetic variants at 1q32.1, 10q11.2 and 19q13.41 are associated with prostate-specific antigen for prostate cancer screening in two Korean population-based cohort studies.
24919509 2014 A genome-wide association study of serum levels of prostate-specific antigen in the Japanese population.
23269536 2013 Genome-wide association study identified novel genetic variant on SLC45A3 gene associated with serum levels prostate-specific antigen (PSA) in a Chinese population.
22821757 2013 Loss of SLC45A3 protein (prostein) expression in prostate cancer is associated with SLC45A3-ERG gene rearrangement and an unfavorable clinical course.
22719019 2012 Chimeric transcript generated by cis-splicing of adjacent genes regulates prostate cancer cell proliferation.
21777423 2011 Diagnostic utility of p63/P501S double sequential immunohistochemical staining in differentiating urothelial carcinoma from prostate carcinoma.
21738478 2011 Identification of nine novel loci associated with white blood cell subtypes in a Japanese population.
20118910 2010 Prevalence of TMPRSS2-ERG and SLC45A3-ERG gene fusions in a large prostatectomy cohort.
19915576 2009 Genome-wide association study identifies common variants at four loci as genetic risk factors for Parkinson's disease.
More...