Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.26
PubTator Score 2.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Alzheimer Disease 83 0.0 0.0
Arthritis, Juvenile 126 0.0 0.0
Disease Target Count
Juvenile arthritis 126
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Alzheimer's disease 658 3.203 0.0236243254476855
Disease Target Count Z-score Confidence
Syndromic X-linked intellectual disability Cabezas type 7 3.843 1.9

Expression

  Differential Expression (39)

Disease log2 FC p
Alzheimer's disease 1.700 2.4e-02
acute quadriplegic myopathy 1.294 1.7e-04
adrenocortical carcinoma -1.321 9.8e-03
astrocytoma 1.700 2.3e-06
Astrocytoma, Pilocytic 1.200 3.5e-05
Atopic dermatitis -1.400 2.4e-02
colon cancer -2.000 4.3e-02
cutaneous lupus erythematosus 3.000 5.4e-04
dermatomyositis 1.700 3.5e-02
Duchenne muscular dystrophy 1.256 4.7e-06
glioblastoma 4.400 8.5e-04
group 4 medulloblastoma -1.400 2.2e-02
head and neck cancer and chronic obstruc... 1.600 2.6e-04
interstitial cystitis 1.500 6.1e-04
intraductal papillary-mucinous adenoma (... -1.300 7.6e-03
intraductal papillary-mucinous carcinoma... -1.300 1.3e-02
intraductal papillary-mucinous neoplasm ... -3.200 1.1e-02
invasive ductal carcinoma 1.799 1.6e-03
juvenile dermatomyositis 1.418 2.5e-06
lung adenocarcinoma -1.100 4.1e-03
lung cancer -1.600 7.2e-03
lung carcinoma -2.300 6.2e-17
malignant mesothelioma 1.200 3.6e-04
medulloblastoma, large-cell -2.000 2.4e-03
Multiple Sclerosis 1.200 8.0e-03
nasopharyngeal carcinoma 1.600 4.4e-03
non-small cell lung cancer -1.450 2.0e-09
oligodendroglioma 1.200 4.7e-04
osteosarcoma -1.064 1.1e-02
ovarian cancer -1.500 6.6e-07
pancreatic ductal adenocarcinoma liver m... -1.760 1.6e-03
pediatric high grade glioma 1.300 1.6e-02
periodontitis 1.100 2.0e-15
posterior fossa group A ependymoma 1.100 4.8e-02
primary Sjogren syndrome 1.600 2.8e-03
psoriasis 1.600 3.0e-03
Systemic lupus erythematosus 1.600 1.6e-03
tuberculosis and treatment for 6 months -1.800 1.5e-03
ulcerative colitis 1.700 1.7e-03

Gene RIF (4)

AA Sequence

MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHLWKGLQEKFLKGEPKVLGVVQ      1 - 70
ILTALMSLSMGITMMCMASNTYGSNPISVYIGYTIWGSVMFIISGSLSIAAGIRTTKGLVRGSLGMNITS     71 - 140
SVLAASGILINTFSLAFYSFHHPYCNYYGNSNNCHGTMSILMGLDGMVLLLSVLEFCIAVSLSAFGCKVL    141 - 210
CCTPGGVVLILPSHSHMAETASPTPLNEV                                             211 - 239
//

Text Mined References (10)

PMID Year Title