Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.35
PubTator Score 2.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 6.15016279901742E-17
periodontitis 269 1.96060841925929E-15
non-small cell lung cancer 2798 7.5085891148477E-10
ovarian cancer 8492 2.65757804567737E-9
lung cancer 4473 1.53370991985535E-6
astrocytoma 1493 2.27282746189266E-6
juvenile dermatomyositis 1189 2.50933313881682E-6
Duchenne muscular dystrophy 602 4.6578452187392E-6
interstitial cystitis 2299 2.94126855125123E-5
acute quadriplegic myopathy 1157 1.70281120521588E-4
malignant mesothelioma 3163 3.55228150746138E-4
oligodendroglioma 2849 4.68208436461666E-4
head and neck cancer and chronic obstructive pulmonary disease 237 5.36374190776482E-4
cutaneous lupus erythematosus 1056 5.40650939070255E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 7.75368022899634E-4
glioblastoma 5572 8.53308533325481E-4
pilocytic astrocytoma 3086 0.00102307157066383
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00156085249267308
invasive ductal carcinoma 2950 0.00157589455539847
systemic lupus erythematosus 172 0.00161939487319993
ulcerative colitis 2087 0.00174088736865651
medulloblastoma, large-cell 6234 0.00235129711484468
primary Sjogren syndrome 789 0.00278553022944321
psoriasis 6685 0.00295076195122088
tuberculosis and treatment for 6 months 686 0.00367000235705188
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00374335520991529
adrenocortical carcinoma 1427 0.00413714071560568
nasopharyngeal carcinoma 1056 0.00439342301366807
Multiple Sclerosis 498 0.00798252407339381
osteosarcoma 7933 0.0112810912522546
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0112867913749724
pediatric high grade glioma 2712 0.015975321504467
lung adenocarcinoma 2714 0.0214934691989033
group 4 medulloblastoma 1875 0.0224729861351567
Atopic dermatitis 944 0.0242489430857761
dermatomyositis 967 0.0353314274970202
colon cancer 1475 0.0431794529373712
posterior fossa group A ependymoma 1511 0.0481991128451924
Disease Target Count Z-score Confidence
Alzheimer's disease 644 3.372 1.7

Expression

Gene RIF (3)

PMID Text
25717186 MS4A4 in human mast cells effects ligand-induced KIT endocytosis pathways and reduced receptor recycling to the cell surface, thus promoting KIT signaling in the endosomes while reducing that in the plasma membrane.
23573206 Single nucleotide polymorphisms in APOE-epsilon4, CLU and MS4A4A influence both Alzheimer disease risk and cerebrospinal fluid Amyloid-beta1-42 levels.
21460841 Common variants at MS4A4/MS4A6E, CD2AP, CD33 and EPHA1 are associated with late-onset Alzheimer's disease.

AA Sequence

MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHLWKGLQEKFLKGEPKVLGVVQ      1 - 70
ILTALMSLSMGITMMCMASNTYGSNPISVYIGYTIWGSVMFIISGSLSIAAGIRTTKGLVRGSLGMNITS     71 - 140
SVLAASGILINTFSLAFYSFHHPYCNYYGNSNNCHGTMSILMGLDGMVLLLSVLEFCIAVSLSAFGCKVL    141 - 210
CCTPGGVVLILPSHSHMAETASPTPLNEV                                             211 - 239
//

Text Mined References (9)

PMID Year Title
25717186 2015 The CD20 homologue MS4A4 directs trafficking of KIT toward clathrin-independent endocytosis pathways and thus regulates receptor signaling and recycling.
23573206 2013 Genetic loci associated with Alzheimer's disease and cerebrospinal fluid biomarkers in a Finnish case-control cohort.
21460841 2011 Common variants at MS4A4/MS4A6E, CD2AP, CD33 and EPHA1 are associated with late-onset Alzheimer's disease.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11486273 2001 Structural organization of the human MS4A gene cluster on Chromosome 11q12.
11401424 2001 Identification of a CD20-, FcepsilonRIbeta-, and HTm4-related gene family: sixteen new MS4A family members expressed in human and mouse.
11245982 2001 Identification of a new multigene four-transmembrane family (MS4A) related to CD20, HTm4 and beta subunit of the high-affinity IgE receptor.