Property Summary

NCBI Gene PubMed Count 11
PubMed Score 17.84
PubTator Score 7.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
adult high grade glioma -1.600 1.5e-02
astrocytoma -1.300 1.7e-09
Astrocytoma, Pilocytic -1.700 5.6e-04
Breast cancer -1.100 1.7e-05
chronic rhinosinusitis -1.057 2.4e-02
colon cancer -1.300 2.4e-02
Down syndrome 1.400 5.3e-04
ependymoma -1.200 8.0e-05
esophageal adenocarcinoma 1.200 2.2e-02
glioblastoma -1.100 1.8e-02
group 3 medulloblastoma -1.600 4.7e-02
intraductal papillary-mucinous adenoma (... 1.300 1.3e-02
intraductal papillary-mucinous carcinoma... 1.100 5.4e-03
lung cancer -2.000 1.7e-03
medulloblastoma, large-cell -1.900 4.1e-03
nasopharyngeal carcinoma -1.500 7.7e-04
oligodendroglioma -1.400 3.5e-08
osteosarcoma -1.273 4.1e-02
ovarian cancer 1.100 6.1e-03
pancreatic cancer 1.100 1.3e-02
pancreatic carcinoma 1.100 1.3e-02
pancreatic ductal adenocarcinoma liver m... -1.413 1.6e-02
Pick disease -1.200 8.7e-03
pituitary cancer 1.100 3.4e-05
primitive neuroectodermal tumor -1.200 1.1e-02
progressive supranuclear palsy -1.300 2.0e-02
psoriasis -1.200 4.9e-08
subependymal giant cell astrocytoma -2.496 6.6e-04
ulcerative colitis -1.100 2.1e-03
urothelial carcinoma -1.700 2.8e-03

Gene RIF (2)

AA Sequence

MAAHEWDWFQREELIGQISDIRVQNLQVERENVQKRTFTRWINLHLEKCNPPLEVKDLFVDIQDGKILMA      1 - 70
LLEVLSGRNLLHEYKSSSHRIFRLNNIAKALKFLEDSNVKLVSIDAAEIADGNPSLVLGLIWNIILFFQI     71 - 140
KELTGNLSRNSPSSSLSPGSGGTDSDSSFPPTPTAERSVAISVKDQRKAIKALLAWVQRKTRKYGVAVQD    141 - 210
FAGSWRSGLAFLAVIKAIDPSLVDMKQALENSTRENLEKAFSIAQDALHIPRLLEPEDIMVDTPDEQSIM    211 - 280
TYVAQFLERFPELEAEDIFDSDKEVPIESTFVRIKETPSEQESKVFVLTENGERTYTVNHETSHPPPSKV    281 - 350
FVCDKPESMKEFRLDGVSSHALSDSSTEFMHQIIDQVLQGGPGKTSDISEPSPESSILSSRKENGRSNSL    351 - 420
PIKKTVHFEADTYKDPFCSKNLSLCFEGSPRVAKESLRQDGHVLAVEVAEEKEQKQESSKIPESSSDKVA    421 - 490
GDIFLVEGTNNNSQSSSCNGALESTARHDEESHSLSPPGENTVMADSFQIKVNLMTVEALEEGDYFEAIP    491 - 560
LKASKFNSDLIDFASTSQAFNKVPSPHETKPDEDAEAFENHAEKLGKRSIKSAHKKKDSPEPQVKMDKHE    561 - 630
PHQDSGEEAEGCPSAPEETPVDKKPEVHEKAKRKSTRPHYEEEGEDDDLQGVGEELSSSPPSSCVSLETL    631 - 700
GSHSEEGLDFKPSPPLSKVSVIPHDLFYFPHYEVPLAAVLEAYVEDPEDLKNEEMDLEEPEGYMPDLDSR    701 - 770
EEEADGSQSSSSSSVPGESLPSASDQVLYLSRGGVGTTPASEPAPLAPHEDHQQRETKENDPMDSHQSQE    771 - 840
SPNLENIANPLEENVTKESISSKKKEKRKHVDHVESSLFVAPGSVQSSDDLEEDSSDYSIPSRTSHSDSS    841 - 910
IYLRRHTHRSSESDHFSYVQLRNAADLDDRRNRILTRKANSSGEAMSLGSHSPQSDSLTQLVQQPDMMYF    911 - 980
ILFLWLLVYCLLLFPQLDVSRL                                                    981 - 1002
//

Text Mined References (15)

PMID Year Title