Property Summary

NCBI Gene PubMed Count 11
PubMed Score 17.65
PubTator Score 7.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Alzheimer's disease 644
Disease Target Count P-value
astrocytoma 1493 1.68493790423864E-9
oligodendroglioma 2849 3.50411897641564E-8
psoriasis 6685 4.94474849470359E-8
Breast cancer 3099 1.65773470573605E-5
pituitary cancer 1972 3.37650345172887E-5
posterior fossa group A ependymoma 1511 1.09753326634197E-4
Down syndrome 548 5.26565523472825E-4
group 4 medulloblastoma 1875 6.50363549984065E-4
subependymal giant cell astrocytoma 2287 6.57749485119403E-4
nasopharyngeal carcinoma 1056 7.7297020732506E-4
pilocytic astrocytoma 3086 8.39049406598956E-4
osteosarcoma 7933 0.00133165376787419
lung cancer 4473 0.00173994027250993
ulcerative colitis 2087 0.00209292210978907
urothelial carcinoma 318 0.00283759260767729
medulloblastoma, large-cell 6234 0.00414155063867739
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00538049101586106
ovarian cancer 8492 0.0060512666023418
Pick disease 1893 0.00866351270433334
primitive neuroectodermal tumor 3031 0.0114002560589855
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0129071535752292
pancreatic cancer 2300 0.0129370709100006
pancreatic carcinoma 567 0.0129370709100006
colon cancer 1475 0.0134112522033209
adult high grade glioma 2148 0.0146140649287915
pancreatic ductal adenocarcinoma liver metastasis 1795 0.016019926160436
progressive supranuclear palsy 674 0.0195525238784098
esophageal adenocarcinoma 737 0.0217097485011888
chronic rhinosinusitis 512 0.0236279875172358
glioblastoma 5572 0.0296857119929144
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (30)

Gene RIF (2)

PMID Text
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of calmin (CLMN) in primary human brain microvascular endothelial cells
20339536 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MAAHEWDWFQREELIGQISDIRVQNLQVERENVQKRTFTRWINLHLEKCNPPLEVKDLFVDIQDGKILMA      1 - 70
LLEVLSGRNLLHEYKSSSHRIFRLNNIAKALKFLEDSNVKLVSIDAAEIADGNPSLVLGLIWNIILFFQI     71 - 140
KELTGNLSRNSPSSSLSPGSGGTDSDSSFPPTPTAERSVAISVKDQRKAIKALLAWVQRKTRKYGVAVQD    141 - 210
FAGSWRSGLAFLAVIKAIDPSLVDMKQALENSTRENLEKAFSIAQDALHIPRLLEPEDIMVDTPDEQSIM    211 - 280
TYVAQFLERFPELEAEDIFDSDKEVPIESTFVRIKETPSEQESKVFVLTENGERTYTVNHETSHPPPSKV    281 - 350
FVCDKPESMKEFRLDGVSSHALSDSSTEFMHQIIDQVLQGGPGKTSDISEPSPESSILSSRKENGRSNSL    351 - 420
PIKKTVHFEADTYKDPFCSKNLSLCFEGSPRVAKESLRQDGHVLAVEVAEEKEQKQESSKIPESSSDKVA    421 - 490
GDIFLVEGTNNNSQSSSCNGALESTARHDEESHSLSPPGENTVMADSFQIKVNLMTVEALEEGDYFEAIP    491 - 560
LKASKFNSDLIDFASTSQAFNKVPSPHETKPDEDAEAFENHAEKLGKRSIKSAHKKKDSPEPQVKMDKHE    561 - 630
PHQDSGEEAEGCPSAPEETPVDKKPEVHEKAKRKSTRPHYEEEGEDDDLQGVGEELSSSPPSSCVSLETL    631 - 700
GSHSEEGLDFKPSPPLSKVSVIPHDLFYFPHYEVPLAAVLEAYVEDPEDLKNEEMDLEEPEGYMPDLDSR    701 - 770
EEEADGSQSSSSSSVPGESLPSASDQVLYLSRGGVGTTPASEPAPLAPHEDHQQRETKENDPMDSHQSQE    771 - 840
SPNLENIANPLEENVTKESISSKKKEKRKHVDHVESSLFVAPGSVQSSDDLEEDSSDYSIPSRTSHSDSS    841 - 910
IYLRRHTHRSSESDHFSYVQLRNAADLDDRRNRILTRKANSSGEAMSLGSHSPQSDSLTQLVQQPDMMYF    911 - 980
ILFLWLLVYCLLLFPQLDVSRL                                                    981 - 1002
//

Text Mined References (15)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
20195266 2011 Genomewide pharmacogenomic study of metabolic side effects to antipsychotic drugs.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...