Property Summary

NCBI Gene PubMed Count 15
PubMed Score 20.12
PubTator Score 16.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
active ulcerative colitis -2.164 2.6e-02
cutaneous lupus erythematosus -4.000 5.8e-04
group 3 medulloblastoma 3.400 1.3e-05
medulloblastoma, large-cell 2.800 9.8e-05
oligodendroglioma 1.500 2.6e-02
pituitary cancer 1.600 4.0e-03
psoriasis -2.300 4.1e-08

Gene RIF (10)

AA Sequence

MRRCRWAALALGLLRLCLAQANFAPHFFDNGVGSTNGNMALFSLPEDTPVGSHVYTLNGTDPEGDPISYH      1 - 70
ISFDPSTRSVFSVDPTFGNITLVEELDREREDEIEAIISISDGLNLVAEKVVILVTDANDEAPRFIQEPY     71 - 140
VALVPEDIPAGSIIFKVHAVDRDTGSGGSVTYFLQNLHSPFAVDRHSGVLRLQAGATLDYERSRTHYITV    141 - 210
VAKDGGGRLHGADVVFSATTTVTVNVEDVQDMAPVFVGTPYYGYVYEDTLPGSEVLKVVAMDGDRGKPNR    211 - 280
ILYSLVNGNDGAFEINETSGAISITQSPAQLQREVYELHVQVTEMSPAGSPAAQATVPVTIRIVDLNNHP    281 - 350
PTFYGESGPQNRFELSMNEHPPQGEILRGLKITVNDSDQGANAKFNLQLVGPRGIFRVVPQTVLNEAQVT    351 - 420
IIVENSAAIDFEKSKVLTFKLLAVEVNTPEKFSSTADVVIQLLDTNDNVPKFDSLYYVARIPENAPGGSS    421 - 490
VVAVTAVDPDTGPWGEVKYSTYGTGADLFLIHPSTGLIYTQPWASLDAEATARYNFYVKAEDMEGKYSVA    491 - 560
EVFITLLDVNDHPPQFGKSVQKKTMVLGTPVKIEAIDEDAEEPNNLVDYSITHAEPANVFDINSHTGEIW    561 - 630
LKNSIRSLDALHNITPGRDCLWSLEVQAKDRGSPSFSTTALLKIDITDAETLSRSPMAAFLIQTKDNPMK    631 - 700
AVGVLAGTMATVVAITVLISTATFWRNKKSNKVLPMRRVLRKRPSPAPRTIRIEWLKSKSTKAATKFMLK    701 - 770
EKPPNENCNNNSPESSLLPRAPALPPPPSVAPSTGAAQWTVPTVSGSLTPQPTQPPPKPKTMGSPVQSTL    771 - 840
ISELKQKFEKKSVHNKAYF                                                       841 - 859
//

Text Mined References (19)

PMID Year Title