Property Summary

NCBI Gene PubMed Count 18
Grant Count 7
R01 Count 7
Funding $870,683.5
PubMed Score 44.18
PubTator Score 8.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.381 0.000
ovarian cancer -1.500 0.000

Gene RIF (5)

PMID Text
24272675 hHgher protein levels of ZFP91 in all cancer cell lines.
22190034 HIV-1 Tat is identified to have a physical interaction with zinc finger protein 91 homolog (ZFP91) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20804734 These data clearly indicate that ZFP91 is a key regulator in LIGHT-induced activation of non-canonical NF-kappaB pathway in LTbetaR signaling.
20682767 An atypical E3 ligase zinc finger protein 91 stabilizes and activates NF-kappaB-inducing kinase via Lys63-linked ubiquitination.
12738986 likely to play an important role in cell proliferation and/or anti-apoptosis, and may serve as a molecular marker for AML

AA Sequence

MPGETEEPRPPEQQDQEGGEAAKAAPEEPQQRPPEAVAAAPAGTTSSRVLRGGRDRGRAAAAAAAAAVSR      1 - 70
RRKAEYPRRRRSSPSARPPDVPGQQPQAAKSPSPVQGKKSPRLLCIEKVTTDKDPKEEKEEEDDSALPQE     71 - 140
VSIAASRPSRGWRSSRTSVSRHRDTENTRSSRSKTGSLQLICKSEPNTDQLDYDVGEEHQSPGGISSEEE    141 - 210
EEEEEEMLISEEEIPFKDDPRDETYKPHLERETPKPRRKSGKVKEEKEKKEIKVEVEVEVKEEENEIRED    211 - 280
EEPPRKRGRRRKDDKSPRLPKRRKKPPIQYVRCEMEGCGTVLAHPRYLQHHIKYQHLLKKKYVCPHPSCG    281 - 350
RLFRLQKQLLRHAKHHTDQRDYICEYCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTCRQKASLNWHMK    351 - 420
KHDADSFYQFSCNICGKKFEKKDSVVAHKAKSHPEVLIAEALAANAGALITSTDILGTNPESLTQPSDGQ    421 - 490
GLPLLPEPLGNSTSGECLLLEAEGMSKSYCSGTERVSLMADGKIFVGSGSSGGTEGLVMNSDILGATTEV    491 - 560
LIEDSDSAGP                                                                561 - 570
//

Text Mined References (19)

PMID Year Title
24272675 2014 ZFP91-a newly described gene potentially involved in prostate pathology.
23349640 2013 Susceptibility loci associated with specific and shared subtypes of lymphoid malignancies.
20804734 2010 Zinc-finger protein 91 plays a key role in LIGHT-induced activation of non-canonical NF-?B pathway.
20682767 2010 An atypical E3 ligase zinc finger protein 91 stabilizes and activates NF-kappaB-inducing kinase via Lys63-linked ubiquitination.
20434516 2010 A retroviral vector common integration site between leupaxin and zinc finger protein 91 (ZFP91) observed in baboon hematopoietic repopulating cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16582619 2006 Identification of novel ARF binding proteins by two-hybrid screening.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...