Property Summary

NCBI Gene PubMed Count 20
PubMed Score 44.78
PubTator Score 8.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 7.1e-07
ovarian cancer 8520 2.8e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Lymphoma 81 0.0 2.2

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.381 7.1e-07
ovarian cancer -1.500 2.8e-06

Gene RIF (7)

AA Sequence

MPGETEEPRPPEQQDQEGGEAAKAAPEEPQQRPPEAVAAAPAGTTSSRVLRGGRDRGRAAAAAAAAAVSR      1 - 70
RRKAEYPRRRRSSPSARPPDVPGQQPQAAKSPSPVQGKKSPRLLCIEKVTTDKDPKEEKEEEDDSALPQE     71 - 140
VSIAASRPSRGWRSSRTSVSRHRDTENTRSSRSKTGSLQLICKSEPNTDQLDYDVGEEHQSPGGISSEEE    141 - 210
EEEEEEMLISEEEIPFKDDPRDETYKPHLERETPKPRRKSGKVKEEKEKKEIKVEVEVEVKEEENEIRED    211 - 280
EEPPRKRGRRRKDDKSPRLPKRRKKPPIQYVRCEMEGCGTVLAHPRYLQHHIKYQHLLKKKYVCPHPSCG    281 - 350
RLFRLQKQLLRHAKHHTDQRDYICEYCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTCRQKASLNWHMK    351 - 420
KHDADSFYQFSCNICGKKFEKKDSVVAHKAKSHPEVLIAEALAANAGALITSTDILGTNPESLTQPSDGQ    421 - 490
GLPLLPEPLGNSTSGECLLLEAEGMSKSYCSGTERVSLMADGKIFVGSGSSGGTEGLVMNSDILGATTEV    491 - 560
LIEDSDSAGP                                                                561 - 570
//

Text Mined References (21)

PMID Year Title