Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.56
PubTator Score 2.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -1.070 0.013
ependymoma -1.300 0.000
glioblastoma -2.200 0.000
group 3 medulloblastoma -2.200 0.000
atypical teratoid / rhabdoid tumor -3.000 0.000
medulloblastoma, large-cell -2.500 0.000
pediatric high grade glioma -2.000 0.000
pilocytic astrocytoma -2.000 0.000
subependymal giant cell astrocytoma -3.370 0.003

Synonym

Accession Q96JN2 A4D1K1 A7MCY7 A8MYA7 Q6ZVK7 Q9H8M3 Q9UFE1
Symbols NAG6

Gene

PANTHER Protein Class (1)

Gene RIF (3)

PMID Text
25065397 CCDC136 locus showed association with a comparable reading/language measure.
20877624 Observational study of gene-disease association. (HuGE Navigator)
15112360 Data suggest that NAG6 may represent a candidate tumor suppressor gene at 7q31-32 loci associated with gastric carcinoma.

AA Sequence

MQAMEGEVLLPALYEEEEEEEEEEEEVEEEEEQVQKGGSVGSLSVNKHRGLSLTETELEELRAQVLQLVA      1 - 70
ELEETRELAGQHEDDSLELQGLLEDERLASAQQAEVFTKQIQQLQGELRSLREEISLLEHEKESELKEIE     71 - 140
QELHLAQAEIQSLRQAAEDSATEHESDIASLQEDLCRMQNELEDMERIRGDYEMEIASLRAEMEMKSSEP    141 - 210
SGSLGLSDYSGLQEELQELRERYHFLNEEYRALQESNSSLTGQLADLESERTQRATERWLQSQTLSMTSA    211 - 280
ESQTSEMDFLEPDPEMQLLRQQLRDAEEQMHGMKNKCQELCCELEELQHHRQVSEEEQRRLQRELKCAQN    281 - 350
EVLRFQTSHSVTQNEELKSRLCTLQKKYDTSQDEQNELLKMQLQLQTELRQLKVMKSTLVENQSEKELLC    351 - 420
RLQKLHLQHQNVTCEKEKLLERQQQLQEELQCHEAELQHLRDTVASFKESNEKDTETHAQLQEMKQLYQA    421 - 490
SKDELERQKHMYDQLEQDLLLCQLELKELKASHPIPEDKGKCANKCDTLLSRLTELQEKYKASQKEMGQL    491 - 560
QMEQCELLEDQRRMQEEQGQLQEELHRLTLPLPKSGLLLKSQELLTKLEDLCELQLLYQGMQEEQKKLIQ    561 - 630
NQDCVLKEQLEIHEELRRFKESHFQEVLENPDDSKLAKSSKCNRNKQSKLLMEQMQALQVMYDAGQAKQE    631 - 700
LLQQEQGRLLEERKRLQADLQLCLEEMQLLQVQSPSIKMSLESYGKSYGSMVPSNENCRKTYDTTVDDNE    701 - 770
SYYKSYTSTQTSSKSFLKSYDSSTSASEAYGKSYCTTSNSSITYKKSYGSTSSSDTCQKSFVSSCTDEEP    771 - 840
AEPEDMERFEEMVVKVLIKLQAVQAMYQISQEEHSQLQEQMEKLLAKQKDLKEELDACEREFKECMECLE    841 - 910
KPMAPQNDKNEIKELQTKLRELQLQYQASMDEQGRLLVVQEQLEGQLQCCQEELRQLREKRPSVVKEARG    911 - 980
KNANKNMNKNANGVKMKKVTKPCSDTSESDLETRKSLEVVLYYKASQRKLDGLAKEEEKKEEMEEEKKQV    981 - 1050
KEEAKEQCGDELVAEPADPEEAKSTEDQEENEEDKEEEEKEEDSEEEEDDADSSLESPEENNPLRLSESK   1051 - 1120
KSSPTPNPPIFSLPLVGLVVISALLWCWWAETSS                                       1121 - 1154
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25065397 2014 Genome-wide screening for DNA variants associated with reading and language traits.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
15112360 2004 Expression of tumor related gene NAG6 in gastric cancer and restriction fragment length polymorphism analysis.
More...