Property Summary

NCBI Gene PubMed Count 29
Grant Count 14
R01 Count 6
Funding $2,775,208.98
PubMed Score 26.40
PubTator Score 18.69

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
22277651 LCoR recruitment by KLF6 regulates expression of the cyclin-dependent kinase inhibitor CDKN1A gene.
21856747 Ligand-dependent corepressor acts as a novel androgen receptor corepressor, inhibits prostate cancer growth, and is functionally inactivated by the Src protein kinase.
21565892 These results showed that the presence of miR-615-3p repressed the expression of LCoR, a derepressor of peroxisome proliferator-activated receptor gamma (PPARgamma).
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19744932 role for LCoR and CtBP1 as attenuators of progesterone-regulated transcription, but LCoR and CtBP1 can act to enhance transcription of some genes
19744931 HDAC6 can function as a cofactor of LCoR but they can act to enhance expression of specific estrogen-regulated genes
12535528 Data show that LCoR (ligand-dependent nuclear receptor corepressor) represents a class of corepressor that attenuates agonist-activated nuclear receptor signaling by multiple mechanisms [Ligand-dependent nuclear receptor corepressor].

AA Sequence

MQRMIQQFAAEYTSKNSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSKLLMADQDSPLDLTVR      1 - 70
KSQSEPSEQDGVLDLSTKKSPCAGSTSLSHSPGCSSTQGNGRPGRPSQYRPDGLRSGDGVPPRSLQDGTR     71 - 140
EGFGHSTSLKVPLARSLQISEELLSRNQLSTAASLGPSGLQNHGQHLILSREASWAKPHYEFNLSRMKFR    141 - 210
GNGALSNISDLPFLAENSAFPKMALQAKQDGKKDVSHSSPVDLKIPQVRGMDLSWESRTGDQYSYSSLVM    211 - 280
GSQTESALSKKLRAILPKQSRKSMLDAGPDSWGSDAEQSTSGQPYPTSDQEGDPGSKQPRKKRGRYRQYN    281 - 350
SEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKERLGTLKNPPKKKMKLMRSEGPDVSVKIELDPQ    351 - 420
GEAAQSANESKNE                                                             421 - 433
//

Text Mined References (29)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24550272 2014 Reciprocal interactions of human C10orf12 and C17orf96 with PRC2 revealed by BioTAP-XL cross-linking and affinity purification.
23502783 2013 The CCND1 c.870G>A polymorphism is a risk factor for t(11;14)(q13;q32) multiple myeloma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22277651 2012 Ligand-dependent corepressor (LCoR) recruitment by Kruppel-like factor 6 (KLF6) regulates expression of the cyclin-dependent kinase inhibitor CDKN1A gene.
21856747 2011 Ligand-dependent corepressor acts as a novel androgen receptor corepressor, inhibits prostate cancer growth, and is functionally inactivated by the Src protein kinase.
21565892 2011 miR-615-3p promotes the phagocytic capacity of splenic macrophages by targeting ligand-dependent nuclear receptor corepressor in cirrhosis-related portal hypertension.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...