Property Summary

NCBI Gene PubMed Count 32
PubMed Score 30.35
PubTator Score 18.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (9)

AA Sequence

MQRMIQQFAAEYTSKNSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSKLLMADQDSPLDLTVR      1 - 70
KSQSEPSEQDGVLDLSTKKSPCAGSTSLSHSPGCSSTQGNGRPGRPSQYRPDGLRSGDGVPPRSLQDGTR     71 - 140
EGFGHSTSLKVPLARSLQISEELLSRNQLSTAASLGPSGLQNHGQHLILSREASWAKPHYEFNLSRMKFR    141 - 210
GNGALSNISDLPFLAENSAFPKMALQAKQDGKKDVSHSSPVDLKIPQVRGMDLSWESRTGDQYSYSSLVM    211 - 280
GSQTESALSKKLRAILPKQSRKSMLDAGPDSWGSDAEQSTSGQPYPTSDQEGDPGSKQPRKKRGRYRQYN    281 - 350
SEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKERLGTLKNPPKKKMKLMRSEGPDVSVKIELDPQ    351 - 420
GEAAQSANESKNE                                                             421 - 433
//

Text Mined References (34)

PMID Year Title