Property Summary

NCBI Gene PubMed Count 16
Grant Count 4
R01 Count 4
Funding $557,479
PubMed Score 9.31
PubTator Score 5.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.300 0.006
tuberculosis and treatment for 6 months 1.700 0.000
Breast cancer -1.200 0.000
gastric carcinoma 1.100 0.031
ovarian cancer -2.100 0.000
pituitary cancer 1.100 0.012

Gene RIF (1)

PMID Text
15889154 The mouse MBT-1 protein influences myelopoiesis by transiently enhancing p57(KIP2) expression levels.

AA Sequence

MTESASSTSGQEFDVFSVMDWKDGVGTLPGSDLKFRVNEFGALEVITDENEMENVKKATATTTWMVPTAQ      1 - 70
EAPTSPPSSRPVFPPAYWTSPPGCPTVFSEKTGMPFRLKDPVKVEGLQFCENCCQYGNVDECLSGGNYCS     71 - 140
QNCARHIKDKDQKEERDVEEDNEEEDPKCSRKKKPKLSLKADTKEDGEERDDEMENKQDVRILRGSQRAR    141 - 210
RKRRGDSAVLKQGLPPKGKKAWCWASYLEEEKAVAVPAKLFKEHQSFPYNKNGFKVGMKLEGVDPEHQSV    211 - 280
YCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCK    281 - 350
AQAAPKSLFENQNITVIPSGFRVGMKLEAVDKKNPSFICVATVTDMVDNRFLVHFDNWDESYDYWCEASS    351 - 420
PHIHPVGWCKEHRRTLITPPGYPNVKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKKMKLEVVDKRNPM    421 - 490
FIRVATVADTDDHRVKVHFDGWNNCYDYWIDADSPDIHPVGWCSKTGHPLQPPLSPLELMEASEHGGCST    491 - 560
PGCKGIGHFKRARHLGPHSAANCPYSEINLNKDRIFPDRLSGEMPPASPSFPRNKRTDANESSSSPEIRD    561 - 630
QHADDVKEDFEERTESEMRTSHEARGAREEPTVQQAQRRSAVFLSFKSPIPCLPLRWEQQSKLLPTVAGI    631 - 700
PASKVSKWSTDEVSEFIQSLPGCEEHGKVFKDEQIDGEAFLLMTQTDIVKIMSIKLGPALKIFNSILMFK    701 - 770
AAEKNSHNEL                                                                771 - 780
//

Text Mined References (21)

PMID Year Title
26317848 2016 The L3MBTL3 Methyl-Lysine Reader Domain Functions As a Dimer.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23292653 2013 Discovery of a chemical probe for the L3MBTL3 methyllysine reader domain.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
More...