Property Summary

NCBI Gene PubMed Count 18
PubMed Score 4.58
PubTator Score 26.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Mental retardation, autosomal dominant 40 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Intellectual disability 1016 3.906 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 4.200 2.2e-02
pancreatic ductal adenocarcinoma liver m... -1.029 1.6e-02
subependymal giant cell astrocytoma -1.488 5.7e-03

Gene RIF (4)

AA Sequence

MEAFQELRKPSARLECDHCSFRGTDYENVQIHMGTIHPEFCDEMDAGGLGKMIFYQKSAKLFHCHKCFFT      1 - 70
SKMYSNVYYHITSKHASPDKWNDKPKNQLNKETDPVKSPPLPEHQKIPCNSAEPKSIPALSMETQKLGSV     71 - 140
LSPESPKPTPLTPLEPQKPGSVVSPELQTPLPSPEPSKPASVSSPEPPKSVPVCESQKLAPVPSPEPQKP    141 - 210
APVSPESVKATLSNPKPQKQSHFPETLGPPSASSPESPVLAASPEPWGPSPAASPESRKSARTTSPEPRK    211 - 280
PSPSESPEPWKPFPAVSPEPRRPAPAVSPGSWKPGPPGSPRPWKSNPSASSGPWKPAKPAPSVSPGPWKP    281 - 350
IPSVSPGPWKPTPSVSSASWKSSSVSPSSWKSPPASPESWKSGPPELRKTAPTLSPEHWKAVPPVSPELR    351 - 420
KPGPPLSPEIRSPAGSPELRKPSGSPDLWKLSPDQRKTSPASLDFPESQKSSRGGSPDLWKSSFFIEPQK    421 - 490
PVFPETRKPGPSGPSESPKAASDIWKPVLSIDTEPRKPALFPEPAKTAPPASPEARKRALFPEPRKHALF    491 - 560
PELPKSALFSESQKAVELGDELQIDAIDDQKCDILVQEELLASPKKLLEDTLFPSSKKLKKDNQESSDAE    561 - 630
LSSSEYIKTDLDAMDIKGQESSSDQEQVDVESIDFSKENKMDMTSPEQSRNVLQFTEEKEAFISEEEIAK    631 - 700
YMKRGKGKYYCKICCCRAMKKGAVLHHLVNKHNVHSPYKCTICGKAFLLESLLKNHVAAHGQSLLKCPRC    701 - 770
NFESNFPRGFKKHLTHCQSRHNEEANKKLMEALEPPLEEQQI                                771 - 812
//

Text Mined References (32)

PMID Year Title