Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.32
PubTator Score 4.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.2e-08
osteosarcoma 7950 7.8e-05
medulloblastoma, large-cell 6241 3.3e-04
group 3 medulloblastoma 4104 2.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.100 2.4e-03
medulloblastoma, large-cell 1.300 3.3e-04
osteosarcoma -1.297 7.8e-05
ovarian cancer 1.100 1.2e-08

Gene RIF (3)

AA Sequence

MESVTFEDVAVEFIQEWALLDSARRSLCKYRMLDQCRTLASRGTPPCKPSCVSQLGQRAEPKATERGILR      1 - 70
ATGVAWESQLKPEELPSMQDLLEEASSRDMQMGPGLFLRMQLVPSIEERETPLTREDRPALQEPPWSLGC     71 - 140
TGLKAAMQIQRVVIPVPTLGHRNPWVARDSAVPARDPAWLQEDKVEEEAMAPGLPTACSQEPVTFADVAV    141 - 210
VFTPEEWVFLDSTQRSLYRDVMLENYRNLASVADQLCKPNALSYLEERGEQWTTDRGVLSDTCAEPQCQP    211 - 280
QEAIPSQDTFTEILSIDVKGEQPQPGEKLYKYNELEKPFNSIEPLFQYQRIHAGEASCECQEIRNSFFQS    281 - 350
AHLIVPEKIRSGDKSYACNKCEKSFRYSSDLIRHEKTHTAEKCFDCQECGQAFKYSSNLRRHMRTHTGEK    351 - 420
PFECSQCGKTFTRNFNLILHQRNHTGEKPYECKDCGKAFNQPSSLRSHVRTHTGEKPFECSQCGKAFREH    421 - 490
SSLKTHLRTHTREKPYECNQCGKPFRTSTHLNVHKRIHTGEKLYECATCGQVLSRLSTLKSHMRTHTGEK    491 - 560
PYVCQECGRAFSEPSSLRKHARTHSGKKPYACQECGRAFGQSSHLIVHVRTHSAGRPYQCNQCEKAFRHS    561 - 630
SSLTVHKRTHVGRETIRNGSLPLSMSHPYCGPLAN                                       631 - 665
//

Text Mined References (8)

PMID Year Title