Property Summary

NCBI Gene PubMed Count 14
Grant Count 6
R01 Count 6
Funding $221,515.67
PubMed Score 7.03
PubTator Score 7.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -1.255 0.015
medulloblastoma 3.100 0.000
atypical teratoid / rhabdoid tumor 1.400 0.026
medulloblastoma, large-cell 2.100 0.002
pancreatic ductal adenocarcinoma liver m... -1.206 0.006
tuberculosis 1.500 0.000
interstitial cystitis -1.200 0.002
lung carcinoma 1.200 0.000
Breast cancer -1.100 0.000
ulcerative colitis -1.400 0.000
ovarian cancer -2.600 0.000
pituitary cancer -1.800 0.002

Synonym

Accession Q96JK9 B2RNU9 B3KVV7 E7EVW8 Mam-3
Symbols GDN
MAM2
CAGH3
ERDA3
MAM-2
TNRC3

Gene

PANTHER Protein Class (1)

Gene RIF (4)

PMID Text
26752546 The present study further expands the genetic spectrum of small blue round cell tumors, with 2 novel fusions, BCOR-MAML3 and ZC3H7B-BCOR, identified
26655998 Suggest that hypoxia promotes SMO transcription through upregulation of MAML3 and RBPJ to induce proliferation, invasiveness and tumorigenesis in pancreatic cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12386158 Identification of new human proteins defines a family that consists of positive regulators for notch signaling

AA Sequence

MGDFAAPAAAANGSSICINSSLNSSLGGAGIGVNNTPNSTPAAPSSNHPAAGGCGGSGGPGGGSAAVPKH      1 - 70
STVVERLRQRIEGCRRHHVNCENRYQQAQVEQLELERRDTVSLYQRTLEQRAKKSGAGTGKQQHPSKPQQ     71 - 140
DAEAASAEQRNHTLIMLQETVKRKLEGARSPLNGDQQNGACDGNFSPTSKRIRKDISAGMEAINNLPSNM    141 - 210
PLPSASPLHQLDLKPSLPLQNSGTHTPGLLEDLSKNGRLPEIKLPVNGCSDLEDSFTILQSKDLKQEPLD    211 - 280
DPTCIDTSETSLSNQNKLFSDINLNDQEWQELIDELANTVPEDDIQDLFNEDFEEKKEPEFSQPATETPL    281 - 350
SQESASVKSDPSHSPFAHVSMGSPQARPSSSGPPFSTVSTATSLPSVASTPAAPNPASSPANCAVQSPQT    351 - 420
PNQAHTPGQAPPRPGNGYLLNPAAVTVAGSASGPVAVPSSDMSPAEQLKQMAAQQQQRAKLMQQKQQQQQ    421 - 490
QQQQQQQQQQQQQQQQQQQQHSNQTSNWSPLGPPSSPYGAAFTAEKPNSPMMYPQAFNNQNPIVPPMANN    491 - 560
LQKTTMNNYLPQNHMNMINQQPNNLGTNSLNKQHNILTYGNTKPLTHFNADLSQRMTPPVANPNKNPLMP    561 - 630
YIQQQQQQQQQQQQQQQQQQPPPPQLQAPRAHLSEDQKRLLLMKQKGVMNQPMAYAALPSHGQEQHPVGL    631 - 700
PRTTGPMQSSVPPGSGGMVSGASPAGPGFLGSQPQAAIMKQMLIDQRAQLIEQQKQQFLREQRQQQQQQQ    701 - 770
QQILAEQQLQQSHLPRQHLQPQRNPYPVQQVNQFQGSPQDIAAVRSQAALQSMRTSRLMAQNAGMMGIGP    771 - 840
SQNPGTMATAAAQSEMGLAPYSTTPTSQPGMYNMSTGMTQMLQHPNQSGMSITHNQAQGPRQPASGQGVG    841 - 910
MVSGFGQSMLVNSAITQQHPQMKGPVGQALPRPQAPPRLQSLMGTVQQGAQSWQQRSLQGMPGRTSGELG    911 - 980
PFNNGASYPLQAGQPRLTKQHFPQGLSQSVVDANTGTVRTLNPAAMGRQMMPSLPGQQGTSQARPMVMSG    981 - 1050
LSQGVPGMPAFSQPPAQQQIPSGSFAPSSQSQAYERNAPQDVSYNYSGDGAGGSFPGLPDGADLVDSIIK   1051 - 1120
GGPGDEWMQELDELFGNP                                                       1121 - 1138
//

Text Mined References (17)

PMID Year Title
26752546 2016 Novel BCOR-MAML3 and ZC3H7B-BCOR Gene Fusions in Undifferentiated Small Blue Round Cell Sarcomas.
26655998 2016 Hypoxia but not normoxia promotes Smoothened transcription through upregulation of RBPJ and Mastermind-like 3 in pancreatic cancer.
25234806 2015 Dissecting the genetics of chronic mucus hypersecretion in smokers with and without COPD.
23708190 2013 A genome-wide association study identifies two risk loci for congenital heart malformations in Han Chinese populations.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...