Property Summary

NCBI Gene PubMed Count 15
Grant Count 9
R01 Count 5
Funding $353,438.33
PubMed Score 5.29
PubTator Score 6.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
juvenile dermatomyositis 1.261 0.000
intraductal papillary-mucinous neoplasm ... 1.300 0.011
ovarian cancer -2.600 0.000

Gene RIF (4)

PMID Text
20485507 Haploinsufficiency for TMX3 results in a small eye phenotype and represents a novel genetic cause of microphthalmia and coloboma.
19240061 Observational study of gene-disease association. (HuGE Navigator)
17881353 analysis of TMX3 interdomain stabilization of the N-terminal redox-active domain
15623505 TMX3 is a thioredoxin-related transmembrane protein of the endoplasmic reticulum

AA Sequence

MAAWKSWTALRLCATVVVLDMVVCKGFVEDLDESFKENRNDDIWLVDFYAPWCGHCKKLEPIWNEVGLEM      1 - 70
KSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQ     71 - 140
QMFEHMQKRHRVFFVYVGGESPLKEKYIDAASELIVYTYFFSASEEVVPEYVTLKEMPAVLVFKDETYFV    141 - 210
YDEYEDGDLSSWINRERFQNYLAMDGFLLYELGDTGKLVALAVIDEKNTSVEHTRLKSIIQEVARDYRDL    211 - 280
FHRDFQFGHMDGNDYINTLLMDELTVPTVVVLNTSNQQYFLLDRQIKNVEDMVQFINNILDGTVEAQGGD    281 - 350
SILQRLKRIVFDAKSTIVSIFKSSPLMGCFLFGLPLGVISIMCYGIYTADTDGGYIEERYEVSKSENENQ    351 - 420
EQIEESKEQQEPSSGGSVVPTVQEPKDVLEKKKD                                        421 - 454
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23728934 2013 Polygenic transmission and complex neuro developmental network for attention deficit hyperactivity disorder: genome-wide association study of both common and rare variants.
21269460 2011 Initial characterization of the human central proteome.
20485507 2010 A male with unilateral microphthalmia reveals a role for TMX3 in eye development.
19995400 2010 Platelets release novel thiol isomerase enzymes which are recruited to the cell surface following activation.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17881353 2007 Structure-function analysis of the endoplasmic reticulum oxidoreductase TMX3 reveals interdomain stabilization of the N-terminal redox-active domain.
More...