Property Summary

NCBI Gene PubMed Count 17
PubMed Score 5.29
PubTator Score 6.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.300 1.1e-02
juvenile dermatomyositis 1.261 4.9e-11
ovarian cancer -2.600 7.6e-08

Gene RIF (5)

AA Sequence

MAAWKSWTALRLCATVVVLDMVVCKGFVEDLDESFKENRNDDIWLVDFYAPWCGHCKKLEPIWNEVGLEM      1 - 70
KSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQ     71 - 140
QMFEHMQKRHRVFFVYVGGESPLKEKYIDAASELIVYTYFFSASEEVVPEYVTLKEMPAVLVFKDETYFV    141 - 210
YDEYEDGDLSSWINRERFQNYLAMDGFLLYELGDTGKLVALAVIDEKNTSVEHTRLKSIIQEVARDYRDL    211 - 280
FHRDFQFGHMDGNDYINTLLMDELTVPTVVVLNTSNQQYFLLDRQIKNVEDMVQFINNILDGTVEAQGGD    281 - 350
SILQRLKRIVFDAKSTIVSIFKSSPLMGCFLFGLPLGVISIMCYGIYTADTDGGYIEERYEVSKSENENQ    351 - 420
EQIEESKEQQEPSSGGSVVPTVQEPKDVLEKKKD                                        421 - 454
//

Text Mined References (21)

PMID Year Title