Property Summary

NCBI Gene PubMed Count 22
Grant Count 3
R01 Count 3
Funding $159,798
PubMed Score 8.39
PubTator Score 4.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.100 0.010
ependymoma 1.100 0.006
oligodendroglioma 1.100 0.002
esophageal adenocarcinoma -1.100 0.020
atypical teratoid / rhabdoid tumor -1.400 0.000
medulloblastoma, large-cell -1.600 0.001
group 4 medulloblastoma 1.200 0.011
subependymal giant cell astrocytoma -2.438 0.003
Pick disease -1.100 0.001
ovarian cancer 2.200 0.000

Synonym

Accession Q96JJ3 E1P5T3 Q5JVZ6 Q7Z5G9 Q96CJ2 Q96ME5 Q96PA9 Q9H938 Q9H9L5 Q9HAH0 Q9NQQ6
Symbols VMPI
CED12
CED-12
ELMO-2
Ced-12A

Gene

PANTHER Protein Class (1)

Gene RIF (4)

PMID Text
25332238 Axl has a role in phosphorylating the Elmo scaffold proteins to promote Rac activation and cell invasion
23184944 uncovered a role for ELMO in the recruitment of ACF7 to the membrane to promote microtubule capture and stability
22568984 Through its association with ELMO2, ILK plays key roles in the regulation of Rho GTPases and cross-talk pathways between adhesion and growth factor receptors.
18602983 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPPPSDIVKVAIEWPGANAQLLEIDQKRPLASIIKEVCDGWSLPNPEYYTLRYADGPQLYITEQTRSDIK      1 - 70
NGTILQLAISPSRAARQLMERTQSSNMETRLDAMKELAKLSADVTFATEFINMDGIIVLTRLVESGTKLL     71 - 140
SHYSEMLAFTLTAFLELMDHGIVSWDMVSITFIKQIAGYVSQPMVDVSILQRSLAILESMVLNSQSLYQK    141 - 210
IAEEITVGQLISHLQVSNQEIQTYAIALINALFLKAPEDKRQDMANAFAQKHLRSIILNHVIRGNRPIKT    211 - 280
EMAHQLYVLQVLTFNLLEERMMTKMDPNDQAQRDIIFELRRIAFDAESDPSNAPGSGTEKRKAMYTKDYK    281 - 350
MLGFTNHINPAMDFTQTPPGMLALDNMLYLAKVHQDTYIRIVLENSSREDKHECPFGRSAIELTKMLCEI    351 - 420
LQVGELPNEGRNDYHPMFFTHDRAFEELFGICIQLLNKTWKEMRATAEDFNKVMQVVREQITRALPSKPN    421 - 490
SLDQFKSKLRSLSYSEILRLRQSERMSQDDFQSPPIVELREKIQPEILELIKQQRLNRLCEGSSFRKIGN    491 - 560
RRRQERFWYCRLALNHKVLHYGDLDDNPQGEVTFESLQEKIPVADIKAIVTGKDCPHMKEKSALKQNKEV    561 - 630
LELAFSILYDPDETLNFIAPNKYEYCIWIDGLSALLGKDMSSELTKSDLDTLLSMEMKLRLLDLENIQIP    631 - 700
EAPPPIPKEPSSYDFVYHYG                                                      701 - 720
//

Text Mined References (24)

PMID Year Title
25332238 2015 Axl phosphorylates Elmo scaffold proteins to promote Rac activation and cell invasion.
24567399 2014 G-protein coupled receptor BAI3 promotes myoblast fusion in vertebrates.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184944 2013 ELMO recruits actin cross-linking family 7 (ACF7) at the cell membrane for microtubule capture and stabilization of cellular protrusions.
22568984 Emerging role of ILK and ELMO2 in the integration of adhesion and migration pathways.
21269460 2011 Initial characterization of the human central proteome.
20679435 2010 Ephexin4 and EphA2 mediate cell migration through a RhoG-dependent mechanism.
18602983 2008 Heterogeneity in gene loci associated with type 2 diabetes on human chromosome 20q13.1.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...