Property Summary

NCBI Gene PubMed Count 25
PubMed Score 9.06
PubTator Score 4.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.100 1.0e-02
atypical teratoid / rhabdoid tumor -1.400 6.1e-05
ependymoma 1.100 5.7e-03
esophageal adenocarcinoma -1.100 2.0e-02
group 4 medulloblastoma 1.200 1.1e-02
medulloblastoma, large-cell -1.600 5.4e-04
oligodendroglioma 1.100 1.7e-03
ovarian cancer 1.400 2.9e-05
Pick disease -1.100 6.2e-04
subependymal giant cell astrocytoma -2.438 2.6e-03

Protein-protein Interaction (2)

Gene RIF (7)

AA Sequence

MPPPSDIVKVAIEWPGANAQLLEIDQKRPLASIIKEVCDGWSLPNPEYYTLRYADGPQLYITEQTRSDIK      1 - 70
NGTILQLAISPSRAARQLMERTQSSNMETRLDAMKELAKLSADVTFATEFINMDGIIVLTRLVESGTKLL     71 - 140
SHYSEMLAFTLTAFLELMDHGIVSWDMVSITFIKQIAGYVSQPMVDVSILQRSLAILESMVLNSQSLYQK    141 - 210
IAEEITVGQLISHLQVSNQEIQTYAIALINALFLKAPEDKRQDMANAFAQKHLRSIILNHVIRGNRPIKT    211 - 280
EMAHQLYVLQVLTFNLLEERMMTKMDPNDQAQRDIIFELRRIAFDAESDPSNAPGSGTEKRKAMYTKDYK    281 - 350
MLGFTNHINPAMDFTQTPPGMLALDNMLYLAKVHQDTYIRIVLENSSREDKHECPFGRSAIELTKMLCEI    351 - 420
LQVGELPNEGRNDYHPMFFTHDRAFEELFGICIQLLNKTWKEMRATAEDFNKVMQVVREQITRALPSKPN    421 - 490
SLDQFKSKLRSLSYSEILRLRQSERMSQDDFQSPPIVELREKIQPEILELIKQQRLNRLCEGSSFRKIGN    491 - 560
RRRQERFWYCRLALNHKVLHYGDLDDNPQGEVTFESLQEKIPVADIKAIVTGKDCPHMKEKSALKQNKEV    561 - 630
LELAFSILYDPDETLNFIAPNKYEYCIWIDGLSALLGKDMSSELTKSDLDTLLSMEMKLRLLDLENIQIP    631 - 700
EAPPPIPKEPSSYDFVYHYG                                                      701 - 720
//

Text Mined References (27)

PMID Year Title