Property Summary

NCBI Gene PubMed Count 19
PubMed Score 6.33
PubTator Score 4.69

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
adult high grade glioma 2148 1.09247407564635E-6
atypical teratoid / rhabdoid tumor 4369 2.27816454892629E-6
group 4 medulloblastoma 1875 5.76371276005446E-6
osteosarcoma 7933 6.02497554771402E-6
medulloblastoma, large-cell 6234 1.90063973203127E-4
tuberculosis and treatment for 6 months 686 4.1681489932184E-4


  Differential Expression (6)


Accession Q96JH7 Q504T4 Q86T93 Q86W01 Q8N3A9 Q9H5R8
Symbols DUBA3


  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (4)

25904330 Phosphorylation and ubiquitination are coordinated via VCIP135 to control Golgi membrane dynamics in the cell cycle.
24163436 VCIP135 phosphorylation regulates its Golgi membrane association and p97 interaction, and thus contributes to the tight control of the Golgi disassembly and reassembly process during the cell cycle.
23500464 the phosphorylation of VCIP135 on Threonine-760 and Serine-767 inhibits p97-mediated Golgi membrane fusion at mitosis
12509440 evidence of tyrosine phosphorylation during sperm capacitation

AA Sequence

SKAQRGNSVEELEEMDSQDAEMTNTTEPMDHS                                         1191 - 1222

Text Mined References (28)

PMID Year Title
25904330 2015 Cell cycle regulation of VCIP135 deubiquitinase activity and function in p97/p47-mediated Golgi reassembly.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24163436 2014 Phosphorylation regulates VCIP135 function in Golgi membrane fusion during the cell cycle.
23827681 2013 OTU deubiquitinases reveal mechanisms of linkage specificity and enable ubiquitin chain restriction analysis.
23500464 2013 Mitotic phosphorylation of VCIP135 blocks p97ATPase-mediated Golgi membrane fusion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.