Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.08
PubTator Score 2.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 3.53921710941391E-7
osteosarcoma 7933 4.08298850088489E-6
medulloblastoma, large-cell 6234 6.43938586224518E-5
Pick disease 1893 1.07062600935486E-4
progressive supranuclear palsy 674 0.0391014013902503
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0411610204101404
Breast cancer 3099 0.0434550869529119
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Western equine encephalitis 11 4.701 2.4

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.415 0.000
medulloblastoma, large-cell -1.400 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.041
Breast cancer 1.900 0.043
Pick disease -1.800 0.000
progressive supranuclear palsy -1.400 0.039
ovarian cancer -1.100 0.000

Synonym

Accession Q96JG6 B3KX22 D1MQ00 F5H5U7 Q75N07 Q8WVK3 Q9H5C6
Symbols VPS54L
CCDC132

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
C. elegans OMA EggNOG

Gene RIF (2)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MQKIKSLMTRQGLKSPQESLSDLGAIESLRVPGKEEFRELREQPSDPQAEQELINSIEQVYFSVDSFDIV      1 - 70
KYELEKLPPVLNLQELEAYRDKLKQQQAAVSKKVADLILEKQPAYVKELERVTSLQTGLQLAAVICTNGR     71 - 140
RHLNIAKEGFTQASLGLLANQRKRQLLIGLLKSLRTIKTLQRTDVRLSEMLEEEDYPGAIQLCLECQKAA    141 - 210
STFKHYSCISELNSKLQDTLEQIEEQLDVALSKICKNFDINHYTKVQQAYRLLGKTQTAMDQLHMHFTQA    211 - 280
IHNTVFQVVLGYVELCAGNTDTKFQKLQYKDLCTHVTPDSYIPCLADLCKALWEVMLSYYRTMEWHEKHD    281 - 350
NEDTASASEGSNMIGTEETNFDRGYIKKKLEHGLTRIWQDVQLKVKTYLLGTDLSIFKYDDFIFVLDIIS    351 - 420
RLMQVGEEFCGSKSEVLQESIRKQSVNYFKNYHRTRLDELRMFLENETWELCPVKSNFSILQLHEFKFME    421 - 490
QSRSPSVSPSKQPVSTSSKTVTLFEQYCSGGNPFEIQANHKDEETEDVLASNGYESDEQEKSAYQEYDSD    491 - 560
SDVPEELKRDYVDEQTGDGPVKSVSRETLKSRKKSDYSLNKVNAPILTNTTLNVIRLVGKYMQMMNILKP    561 - 630
IAFDVIHFMSQLFDYYLYAIYTFFGRNDSLESTGLGLSSSRLRTTLNRIQESLIDLEVSADPTATLTAAE    631 - 700
ERKEKVPSPHLSHLVVLTSGDTLYGLAERVVATESLVFLAEQFEFLQPHLDAVMPAVKKPFLQQFYSQTV    701 - 770
STASELRKPIYWIVAGKALDYEQMLLLMANVKWDVKEIMSQHNIYVDALLKEFEQFNRRLNEVSKRVRIP    771 - 840
LPVSNILWEHCIRLANRTIVEGYANVKKCSNEGRALMQLDFQQFLMKLEKLTDIRPIPDKEFVETYIKAY    841 - 910
YLTENDMERWIKEHREYSTKQLTNLVNVCLGSHINKKARQKLLAAIDDIDRPKR                    911 - 964
//

Text Mined References (27)

PMID Year Title
25799061 2015 EARP is a multisubunit tethering complex involved in endocytic recycling.
25453831 2014 Toward a comprehensive map of the effectors of rab GTPases.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21472204 CCDC132 is highly expressed in atopic dermatitis T cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...