Property Summary

NCBI Gene PubMed Count 18
PubMed Score 89.37
PubTator Score 27.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Hyperactive behavior 31
Disease Target Count P-value
psoriasis 6685 4.12235687969132E-84
glioblastoma 5572 1.09852251571635E-4
pilocytic astrocytoma 3086 1.11176852646987E-4
group 4 medulloblastoma 1875 0.00165523879179992
adrenocortical carcinoma 1427 0.00367087106607097
adult high grade glioma 2148 0.00390397899038124
primitive neuroectodermal tumor 3031 0.0316458312042234

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma -1.100 0.000
group 4 medulloblastoma 1.500 0.002
primitive neuroectodermal tumor 1.400 0.032
adrenocortical carcinoma -1.072 0.004
adult high grade glioma -1.200 0.004
pilocytic astrocytoma -1.200 0.000
psoriasis -1.600 0.000

Synonym

Accession Q96JE9 A7E2A1 Q6P3T0 Q6ZWB8 MAP-6
Symbols STOP
MTAP6
MAP6-N
N-STOP

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Anole lizard EggNOG Inparanoid
Xenopus EggNOG Inparanoid

Gene RIF (6)

PMID Text
24357581 These data show that TMEM106B/MAP6 interaction is crucial for controlling dendritic trafficking of lysosomes, presumably by acting as a molecular brake for retrograde transport.
23831686 Structural basis for the association of MAP6 protein with microtubules and its regulation by calmodulin.
22904321 MAP6 might serve as a temperature sensor adapting its conformation according to the temperature to maintain the cellular microtubule network in organisms exposed to temperature decrease.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
16624526 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAWPCITRACCIARFWNQLDKADIAVPLVFTKYSEATEHPGAPPQPPPPQQQAQPALAPPSARAVAIETQ      1 - 70
PAQGELDAVARATGPAPGPTGEREPAAGPGRSGPGPGLGSGSTSGPADSVMRQDYRAWKVQRPEPSCRPR     71 - 140
SEYQPSDAPFERETQYQKDFRAWPLPRRGDHPWIPKPVQISAASQASAPILGAPKRRPQSQERWPVQAAA    141 - 210
EAREQEAAPGGAGGLAAGKASGADERDTRRKAGPAWIVRRAEGLGHEQTPLPAAQAQVQATGPEAGRGRA    211 - 280
AADALNRQIREEVASAVSSSYRNEFRAWTDIKPVKPIKAKPQYKPPDDKMVHETSYSAQFKGEASKPTTA    281 - 350
DNKVIDRRRIRSLYSEPFKEPPKVEKPSVQSSKPKKTSASHKPTRKAKDKQAVSGQAAKKKSAEGPSTTK    351 - 420
PDDKEQSKEMNNKLAEAKESLAQPVSDSSKTQGPVATEPDKDQGSVVPGLLKGQGPMVQEPLKKQGSVVP    421 - 490
GPPKDLGPMIPLPVKDQDHTVPEPLKNESPVISAPVKDQGPSVPVPPKNQSPMVPAKVKDQGSVVPESLK    491 - 560
DQGPRIPEPVKNQAPMVPAPVKDEGPMVSASVKDQGPMVSAPVKDQGPIVPAPVKGEGPIVPAPVKDEGP    561 - 630
MVSAPIKDQDPMVPEHPKDESAMATAPIKNQGSMVSEPVKNQGLVVSGPVKDQDVVVPEHAKVHDSAVVA    631 - 700
PVKNQGPVVPESVKNQDPILPVLVKDQGPTVLQPPKNQGRIVPEPLKNQVPIVPVPLKDQDPLVPVPAKD    701 - 770
QGPAVPEPLKTQGPRDPQLPTVSPLPRVMIPTAPHTEYIESSP                               771 - 813
//

Text Mined References (20)

PMID Year Title
26198635 2015 Identification of a Novel Sequence Motif Recognized by the Ankyrin Repeat Domain of zDHHC17/13 S-Acyltransferases.
24357581 2014 The FTLD risk factor TMEM106B and MAP6 control dendritic trafficking of lysosomes.
23831686 2013 Structural basis for the association of MAP6 protein with microtubules and its regulation by calmodulin.
22904321 2012 MAP6-F is a temperature sensor that directly binds to and protects microtubules from cold-induced depolymerization.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
17210638 2007 Calpain 6 is involved in microtubule stabilization and cytoskeletal organization.
16624526 2006 Genetic and expression analyses of the STOP (MAP6) gene in schizophrenia.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...