Property Summary

NCBI Gene PubMed Count 16
Grant Count 5
R01 Count 5
Funding $350,571.5
PubMed Score 0.79
PubTator Score 6.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.400 0.040
osteosarcoma -2.023 0.000
intraductal papillary-mucinous neoplasm ... 1.600 0.036
spina bifida -1.011 0.034
acute myeloid leukemia 1.200 0.001
ovarian cancer 1.400 0.001

Gene RIF (3)

PMID Text
20161747 Findings provide the first convincing line of evidence that EAF and Wnt4 form an auto-regulatory negative feedback loop in vivo.
16114057 ELL may be an important factor required for U19/Eaf2 function because U19/Eaf2 nuclear localization and transactivation activity are essential for its function as a transcription factor.
16006523 ELL-associated factors 1 and 2 are positive regulators of RNA polymerase II elongation factor ELL.

AA Sequence

MNGTANPLLDREEHCLRLGESFEKRPRASFHTIRYDFKPASIDTSCEGELQVGKGDEVTITLPHIPGSTP      1 - 70
PMTVFKGNKRPYQKDCVLIINHDTGEYVLEKLSSSIQVKKTRAEGSSKIQARMEQQPTRPPQTSQPPPPP     71 - 140
PPMPFRAPTKPPVGPKTSPLKDNPSPEPQLDDIKRELRAEVDIIEQMSSSSGSSSSDSESSSGSDDDSSS    141 - 210
SGGEDNGPASPPQPSHQQPYNSRPAVANGTSRPQGSNQLMNTLRNDLQLSESGSDSDD                211 - 268
//

Text Mined References (23)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22895430 2012 The super elongation complex (SEC) family in transcriptional control.
22195968 2011 The little elongation complex regulates small nuclear RNA transcription.
21729782 2011 Human mediator subunit MED26 functions as a docking site for transcription elongation factors.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20161747 2010 Negative feedback regulation of Wnt4 signaling by EAF1 and EAF2/U19.
More...