Property Summary

NCBI Gene PubMed Count 31
PubMed Score 22.15
PubTator Score 26.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 0.018
intraductal papillary-mucinous adenoma (... -1.200 0.000
breast carcinoma -1.200 0.003
cystic fibrosis 1.600 0.000
Breast cancer -2.000 0.000
psoriasis -1.600 0.000

Synonym

Accession Q96JB6 Q5W0B3 Q96DY1 Q96PC0 Q9H6T5
Symbols LOXC

Gene

PANTHER Protein Class (3)

Gene RIF (18)

PMID Text
26097573 In hepatocellular carcinoma, low LOXL4 expression was associated with lower overall survival rates and higher cumulative recurrence rates.
25311867 These results provide a set of the essential genes in this newly identified miR-193a-3p/LOXL4/Oxidative Stress axis.
25216702 High Lysyl oxidase-like 4 promotes proliferation and metastasis of gastric cancer via FAK/Src pathway.
24357854 data suggest that abnormal expression of LOXL4 of KCOT may enhance angiogenesis in KCOT, which may help to promote the locally aggressive biological behavior of KCOT.
23357697 TGF-beta1 induced injured MCL to express more LOXs than injured ACL (up to 1.85-fold in LOX, 2.21-fold in LOXL-1, 1.71-fold in LOXL-2, 2.52-fold in LOXL-3 and 3.32-fold in LOXL-4).
22806361 Alternatively spliced lysyl oxidase-like 4 isoforms have a pro-metastatic role in cancer.
21740577 The human lysyl oxidase-like 4 gene does not confer increased genotypic risk for adolescent idiopathic scoliosis.
21733505 SNPs in the lysyl oxidase-like protein 4 and complement component 3 genes are associated with increased risk for endometriosis and endometriosis-associated infertility in a Puerto Rican population.
21115907 Overexpression of the lysyl oxidase-like 4 gene is associated with metastatic head/neck carcinoma.
19015874 In breast carcinoma, LOXL4 was expressed only in the effusion samples. In malignant mesothelioma, LOXL4 and its splice variants were expressed at all sites.
More...

AA Sequence

MAWSPPATLFLFLLLLGQPPPSRPQSLGTTKLRLVGPESKPEEGRLEVLHQGQWGTVCDDNFAIQEATVA      1 - 70
CRQLGFEAALTWAHSAKYGQGEGPIWLDNVRCVGTESSLDQCGSNGWGVSDCSHSEDVGVICHPRRHRGY     71 - 140
LSETVSNALGPQGRRLEEVRLKPILASAKQHSPVTEGAVEVKYEGHWRQVCDQGWTMNNSRVVCGMLGFP    141 - 210
SEVPVDSHYYRKVWDLKMRDPKSRLKSLTNKNSFWIHQVTCLGTEPHMANCQVQVAPARGKLRPACPGGM    211 - 280
HAVVSCVAGPHFRPPKTKPQRKGSWAEEPRVRLRSGAQVGEGRVEVLMNRQWGTVCDHRWNLISASVVCR    281 - 350
QLGFGSAREALFGARLGQGLGPIHLSEVRCRGYERTLSDCPALEGSQNGCQHENDAAVRCNVPNMGFQNQ    351 - 420
VRLAGGRIPEEGLLEVQVEVNGVPRWGSVCSENWGLTEAMVACRQLGLGFAIHAYKETWFWSGTPRAQEV    421 - 490
VMSGVRCSGTELALQQCQRHGPVHCSHGGGRFLAGVSCMDSAPDLVMNAQLVQETAYLEDRPLSQLYCAH    491 - 560
EENCLSKSADHMDWPYGYRRLLRFSTQIYNLGRTDFRPKTGRDSWVWHQCHRHYHSIEVFTHYDLLTLNG    561 - 630
SKVAEGHKASFCLEDTNCPTGLQRRYACANFGEQGVTVGCWDTYRHDIDCQWVDITDVGPGNYIFQVIVN    631 - 700
PHYEVAESDFSNNMLQCRCKYDGHRVWLHNCHTGNSYPANAELSLEQEQRLRNNLI                  701 - 756
//

Text Mined References (33)

PMID Year Title
26097573 2015 LOXL4 is downregulated in hepatocellular carcinoma with a favorable prognosis.
25416956 2014 A proteome-scale map of the human interactome network.
25311867 2014 miR-193a-3p regulates the multi-drug resistance of bladder cancer by targeting the LOXL4 gene and the oxidative stress pathway.
25216702 2015 Lysyl oxidase-like 4 (LOXL4) promotes proliferation and metastasis of gastric cancer via FAK/Src pathway.
24357854 2014 Identification of the involvement of LOXL4 in generation of keratocystic odontogenic tumors by RNA-Seq analysis.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23357697 2013 TGF-beta1 induces the different expressions of lysyl oxidases and matrix metalloproteinases in anterior cruciate ligament and medial collateral ligament fibroblasts after mechanical injury.
22806361 2013 Alternatively spliced lysyl oxidase-like 4 isoforms have a pro-metastatic role in cancer.
21740577 2011 Common polymorphisms in human lysyl oxidase genes are not associated with the adolescent idiopathic scoliosis phenotype.
More...