Property Summary

NCBI Gene PubMed Count 37
PubMed Score 19.74
PubTator Score 45.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 2.00687450045929E-8
osteosarcoma 7933 6.44198122109759E-7
lung adenocarcinoma 2714 9.31802206861756E-5
Pick disease 1893 2.54045743502483E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 4.68056292306571E-4
astrocytoma 1493 9.38230212808052E-4
group 3 medulloblastoma 2254 0.00317600218695706
oligodendroglioma 2849 0.00460590668864402
progressive supranuclear palsy 674 0.00490102984234061
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0301648895264673

Expression

  Differential Expression (10)

Synonym

Accession Q96JB5 B7Z6N4 D3DTU1 D3DTU2 F5H3I5 Q53FA2 Q9H3F8 Q9H8G0 Q9HBR9
Symbols C53
IC53
LZAP
HSF-27
MST016
PP1553
OK/SW-cl.114

Gene

  Ortholog (13)

 MGI Term (1)

Pathway (1)

Gene RIF (16)

PMID Text
23478299 C53/LZAP protein bound indirectly to the microtubule (MT), and expression of the C53/LZAP cleavage product caused abnormal MT bundling and NE rupture.
22860085 our findings provide the new evidence that overexpression of CDK5RAP3 promotes HCC metastasis via downregulation of p14(ARF).
22028922 LZAP may play an important role in hepatocellular carcinoma progression
21971960 our results strongly suggest that the binding of hepatitis viral pre-S2 LHBs with C53 is a novel negative regulator of the checkpoint response
21465471 Nuclear gamma-tubulin interacts with tumor suppressor protein C53 that is involved in regulation of DNA damage
21394385 Data indicate that IC53 is a positive mediator for colon cancer progression, and IC53-rs2737 may serve as protection from the onset of colorectal cancer.
21385901 Findings reveal that CDK5RAP3 is widely overexpressed in hepatocellular carcinoma and that overexpression of CDK5RAP3 promotes HCC metastasis through PAK4 activation.
21283629 the ability of LZAP to alter p38 phosphorylation depended, at least partially, on the p38 phosphatase, Wip1
20228063 found that C53/LZAP and DDRGK1 became more susceptible to the proteasome-mediated degradation in RCAD knockdown cells, whereas their ubiquitination was significantly attenuated by RCAD overexpression
19541669 Endothelium-specific overexpression of human IC53 downregulates endothelial nitric oxide synthase activity and elevates systolic blood pressure in mice.
More...

AA Sequence

MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHYFHCLR      1 - 70
ILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQ     71 - 140
QEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQA    141 - 210
SVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQVAEDAIDWGDFGVEAVSEG    211 - 280
TDSGISAEAAGIDWGIFPESDSKDPGGDGIDWGDDAVALQITVLEAGTQAPEGVARGPDALTLLEYTETR    281 - 350
NQFLDELMELEIFLAQRAVELSEEADVLSVSQFQLAPAILQGQTKEKMVTMVSVLEDLIGKLTSLQLQHL    351 - 420
FMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADI    421 - 490
SKRYSGRPVNLMGTSL                                                          491 - 506
//

Text Mined References (42)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23478299 2013 Caspase-mediated cleavage of C53/LZAP protein causes abnormal microtubule bundling and rupture of the nuclear envelope.
23152784 2012 Transcriptional regulation of the Ufm1 conjugation system in response to disturbance of the endoplasmic reticulum homeostasis and inhibition of vesicle trafficking.
22949513 2012 Genome-wide association analysis of genetic generalized epilepsies implicates susceptibility loci at 1q43, 2p16.1, 2q22.3 and 17q21.32.
22860085 2012 CDK5RAP3 is a novel repressor of p14ARF in hepatocellular carcinoma cells.
22028922 2011 Identification of LZAP as a new candidate tumor suppressor in hepatocellular carcinoma.
More...