Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.32
PubTator Score 3.49

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.200 3.9e-04
group 4 medulloblastoma 1.100 4.6e-03
lung cancer 1.100 2.0e-02
malignant mesothelioma 4.700 5.7e-10
medulloblastoma, large-cell 1.100 3.0e-02
osteosarcoma -2.195 5.0e-07
ovarian cancer 1.200 4.1e-05
primitive neuroectodermal tumor 1.400 1.8e-02
psoriasis -1.300 3.6e-09
spina bifida -1.187 1.1e-02

Gene RIF (2)

AA Sequence

MVSGPLALRWCAWAGRGDMGPDMELPSHSKQLLLQLNQQRTKGFLCDVIIMVENSIFRAHKNVLAASSIY      1 - 70
FKSLVLHDNLINLDTDMVSSTVFQQILDFIYTGKLLPSDQPAEPNFSTLLTAASYLQLPELAALCRRKLK     71 - 140
RAGKPFGSGRAGSTGMGRPPRSQRLSTASVIQARYQGLVDGRKGAHAPQELPQAKGSDDELFLGGSNQDS    141 - 210
VQGLGRAVCPAGGEAGLGGCSSSTNGSSGGCEQELGLDLSKKSPPLPPATPGPHLTPDDAAQLSDSQHGS    211 - 280
PPAASAPPVANSASYSELGGTPDEPMDLEGAEDNHLSLLEAPGGQPRKSLRHSTRKKEWGKKEPVAGSPF    281 - 350
ERREAGPKGPCPGEEGEGVGDRVPNGILASGAGPSGPYGEPPYPCKEEEENGKDASEDSAQSGSEGGSGH    351 - 420
ASAHYMYRQEGYETVSYGDNLYVCIPCAKGFPSSEQLNAHVETHTEEELFIKEEGAYETGSGGAEEEAED    421 - 490
LSAPSAAYTAEPRPFKCSVCEKTYKDPATLRQHEKTHWLTRPFPCNICGKMFTQRGTMTRHMRSHLGLKP    491 - 560
FACDECGMRFTRQYRLTEHMRVHSGEKPYECQLCGGKFTQQRNLISHLRMHTSPS                   561 - 615
//

Text Mined References (18)

PMID Year Title